New alternative splicing variants of the ATXN2 transcript

New alternative splicing variants of the ATXN2 transcript
Background: Spinocerebellar ataxia sort 2 (SCA2) is an autosomal dominant dysfunction with progressive degeneration of cerebellar Purkinje cells and selective lack of neurons within the brainstem. This neurodegenerative dysfunction is attributable to the enlargement of a polyglutamine area in ataxin-2. Ataxin-2 consists of 1312 amino acids, has a predicted molecular weight of 150-kDa and is extensively expressed in neuronal and non-neuronal tissues. Up to now, the putative features of ataxin-2 on mRNA translation and endocytosis stay ill-defined. Differential splicing with a scarcity of exons 10 and 21 was described in people, and extra splicing of exon 11 in mice. On this research, we noticed that the molecular dimension of transfected full-length wild-type ataxin-2 (22 glutamines) is completely different from endogenous ataxin-2 and that this variation couldn’t be defined by the beforehand printed splice variants alone.
Strategies: Quantitative immunoblots and qualitative reverse-transcriptase polymerase-chain-reaction (RT-PCR) have been used to characterize isoform variants, earlier than sequencing was employed for validation.
Outcomes: We report the characterization of additional splice variants of ataxin-2 in numerous human cell traces and in mouse and human mind. Utilizing RT-PCR from cell traces HeLa, HEK293 and COS-7 all through the open studying body of ataxin-2 along with PCR-sequencing, we discovered novel splice variants missing exon 12 and exon 24. These findings have been corroborated in murine and human mind. The splice variants have been additionally present in human pores and skin fibroblasts from SCA2 sufferers and controls, indicating that the polyglutamine enlargement doesn’t abolish the splicing.
Conclusions: Provided that Ataxin-2 interacts with essential splice modulators comparable to TDP-43 and modulates the danger of Amyotrophic Lateral Sclerosis, its personal splice isoforms might turn out to be related in mind tissue to watch the RNA processing throughout illness development and neuroprotective remedy.

Overexpression of FKH-2/FOXG1 is neuroprotective in a C. elegans mannequin of Machado-Joseph illness

Machado-Joseph illness (MJD), also referred to as spinocerebellar ataxia sort 3 (SCA3), is the commonest type of dominantly inherited ataxia worldwide. This illness is attributable to an expanded CAG repeat within the coding area of ATXN3. As a consequence of our incomplete understanding of mechanisms and molecular pathways associated to this illness, there aren’t any therapies that efficiently deal with core MJD sufferers. Due to this fact, the identification of recent candidate targets associated to this illness is required. On this research, we carried out a large-scale RNA interference (RNAi) display screen of 387 transcription issue genes resulting in the identification of a number of modifiers (suppressors and enhancers) of impaired motility phenotypes in a mutant ATXN3 transgenic C. elegans mannequin. We confirmed that inactivation of 1 explicit gene, fkh-2/FOXG1, enhanced the motility defect, neurodegeneration and diminished longevity in our MJD fashions.
Reverse to genetic inactivation, the overexpression of fkh-2 rescued the impaired motility, shortened-lifespan, and neurodegeneration phenotypes of mutant ATXN3 transgenics. We discovered that overexpression of mutant worms is neuroprotective. Utilizing our transgenic ATXN3 C. elegans fashions and the screening of an RNAi library, we gained insights into the pathways contributing to neurodegeneration, and located that has neuroprotective exercise. These findings might assist the event of novel therapeutic interventions for MJD. Enlargement of a CAG repeat in ATXN3 causes the dominant polyglutamine illness spinocerebellar ataxia sort 3 (SCA3), but the physiological function of ATXN3 stays unclear.
Right here, we concentrate on unveiling the perform of Ataxin-3  within the retina, a neurological organ amenable to morphological and physiological research. Depletion of Atxn3 in zebrafish and mice causes morphological and practical retinal alterations and, extra exactly, photoreceptor cilium and outer section elongation, cone opsin mislocalization, and cone hyperexcitation. ATXN3 localizes on the basal physique and axoneme of the cilium, supporting its function in regulating ciliary size.
 New alternative splicing variants of the ATXN2 transcript

New alternative splicing variants of the ATXN2 transcript

RAN translation of the expanded CAG repeats within the SCA3 illness context

Spinocerebellar ataxia sort 3 (SCA3) is a progressive neurodegenerative dysfunction attributable to a CAG repeat enlargement within the ATXN3 gene encoding the ataxin-Three protein. Regardless of intensive analysis the precise pathogenic mechanisms of SCA3 are nonetheless not understood in depth. Within the current research, to realize perception into the toxicity induced by the expanded CAG repeats in SCA3, we comprehensively investigated repeat-associated non-ATG (RAN) translation in numerous mobile fashions expressing translated or non-canonically translated ATXN3 sequences with an growing variety of CAG repeats.
We display that two SCA3 RAN proteins, polyglutamine (polyQ) and polyalanine (polyA), are discovered solely within the case of CAG repeats of pathogenic size. Regardless of having distinct mobile localization, RAN polyQ and RAN polyA proteins are fairly often coexpressed in the identical cell, impairing nuclear integrity and inducing apoptosis. We offer for the primary time mechanistic insights into SCA3 RAN translation indicating that ATXN3 sequences surrounding the repeat area have an effect on SCA3 RAN translation initiation and effectivity. We revealed that RAN translation of polyQ proteins begins at non-cognate codons upstream of the CAG repeats, whereas RAN polyA proteins are seemingly translated inside repeats.

Anti-Ofloxacin antibody *Mouse anti-human, monoclonal IgG2b*

V100235 50 ug
EUR 367.2

Anti-Ofloxacin antibody *Mouse anti-human, monoclonal IgG2b*

V100236 1 mg
EUR 1306.8

Anti-Enrofloxacin antibody *Mouse anti-human, monoclonal IgG2b*

V100260 50 ug
EUR 367.2

Anti-Enrofloxacin antibody *Mouse anti-human, monoclonal IgG2b*

V100261 1 mg
EUR 1306.8

Mouse anti Rat IgG2b

41R-1119 100 ug
EUR 318
Description: Mouse anti Rat IgG2b secondary antibody

Rabbit anti Mouse IgG2b

40C-CB5134 1 mg
EUR 408
Description: Rabbit anti Mouse IgG2b secondary antibody

Goat anti Mouse IgG2b

FNSA-0088 500 uL
EUR 367.92
Description: Goat anti Mouse IgG2b secondary antibody

Anti-Mouse IgG2b antibody

STJ16100634 1 mL
EUR 844.8

Anti-Mouse IgG2b antibody

STJ16100635 1 mL
EUR 1029.6

Anti-Mouse IgG2b antibody

STJ16100636 1 mL
EUR 1045.2

Anti-Mouse IgG2b antibody

STJ16100637 1 mL
EUR 1786.8

CF350 Goat Anti-Mouse IgG2b (γ2b), 2mg/mL

20265-1 50uL
EUR 178.8
Description: Minimum order quantity: 1 unit of 50uL

CF488A Goat Anti-Mouse IgG2b (γ2b), 2mg/mL

20266-1 50uL
EUR 178.8
Description: Minimum order quantity: 1 unit of 50uL

CF555 Goat Anti-Mouse IgG2b (γ2b), 2mg/mL

20267-1 50uL
EUR 178.8
Description: Minimum order quantity: 1 unit of 50uL

CF568 Goat Anti-Mouse IgG2b (γ2b), 2mg/mL

20268-1 50uL
EUR 178.8
Description: Minimum order quantity: 1 unit of 50uL

CF594 Goat Anti-Mouse IgG2b (γ2b), 2mg/mL

20269-1 50uL
EUR 178.8
Description: Minimum order quantity: 1 unit of 50uL

CF633 Goat Anti-Mouse IgG2b (γ2b), 2mg/mL

20270-1 50uL
EUR 178.8
Description: Minimum order quantity: 1 unit of 50uL

CF640R Goat Anti-Mouse IgG2b (γ2b), 2mg/mL

20271-1 50uL
EUR 178.8
Description: Minimum order quantity: 1 unit of 50uL

CF647 Goat Anti-Mouse IgG2b (γ2b), 2mg/mL

20272-1 50uL
EUR 178.8
Description: Minimum order quantity: 1 unit of 50uL

CF680 Goat Anti-Mouse IgG2b (γ2b), 2mg/mL

20273-1 50uL
EUR 193.2
Description: Minimum order quantity: 1 unit of 50uL

CF770 Goat Anti-Mouse IgG2b (γ2b), 2mg/mL

20274-1 50uL
EUR 193.2
Description: Minimum order quantity: 1 unit of 50uL

CF543 Goat Anti-Mouse IgG2b (γ2b), 2mg/mL

20327-1 50uL
EUR 178.8
Description: Minimum order quantity: 1 unit of 50uL

Anti-Myeloperoxidase (MPO) antibody *Mouse anti-human, monoclonal IgG2b*

V100095 50 ug
EUR 367.2

Anti-Myeloperoxidase (MPO) antibody *Mouse anti-human, monoclonal IgG2b*

V100096 1 mg
EUR 889.2

Anti-Procalcitonin (PCT) antibody *Mouse anti-human, monoclonal IgG2b*

V100115 50 ug
EUR 367.2

Anti-Procalcitonin (PCT) antibody *Mouse anti-human, monoclonal IgG2b*

V100116 1 mg
EUR 471.6

Anti-Prolactin (PRL) antibody *Mouse anti-human, monoclonal IgG2b*

V100160 50 ug
EUR 367.2

Anti-Prolactin (PRL) antibody *Mouse anti-human, monoclonal IgG2b*

V100161 1 mg
EUR 471.6

Anti-Folic acid antibody *Mouse anti-human, monoclonal IgG2b*

V100200 50 ug
EUR 367.2

Anti-Folic acid antibody *Mouse anti-human, monoclonal IgG2b*

V100201 1 mg
EUR 889.2

Anti-Chenodeoxycholic acid antibody *Mouse anti-human, monoclonal IgG2b*

V100225 50 ug
EUR 367.2

Anti-Chenodeoxycholic acid antibody *Mouse anti-human, monoclonal IgG2b*

V100226 1 mg
EUR 889.2

Mouse Anti-Ovalbumin IgG2b Monoclonal Antibody, Clone 4B4E6

7096 1 mg/ml x 0.1 ml
EUR 406.26
Description: Mouse Anti-Ovalbumin IgG2b Monoclonal Antibody

Mouse Anti-SEB IgG2b Monoclonal Antibody, Clone 5D12C9

7105 1 mg/ml x 0.1 ml
EUR 578.52
Description: Mouse Anti-SEB IgG2b Monoclonal Antibody

Mouse Anti-SEA IgG2b Monoclonal Antibody, Clone 1E10G12

7108 1 mg/ml x 0.1 ml
EUR 578.52
Description: Mouse Anti-SEA IgG2b Monoclonal Antibody

Mouse Anti-HDM IgG2b Monoclonal Antibody, Clone 3C4H2

7112 1 mg/ml x 0.1 ml
EUR 406.26
Description: Mouse Anti-HDM IgG2b Monoclonal Antibody

Mouse Anti-Ro60 IgG2b Monoclonal Antibody, Clone 2D6E12

7125 1 mg/ml x 0.1 ml
EUR 406.26
Description: Mouse Anti-Ro60 IgG2b Monoclonal Antibody

Anti-Mouse IgG2b Rabbit Monoclonal Antibody, Clone#RM108

M33092 100ug
EUR 450
Description: Anti-Mouse IgG2b Rabbit Monoclonal Antibody, Clone#RM108 tested in WB (stronger on nonreduced), IP, ICC, IHC, FC, ELISA , reactive to Mouse

HRP-Goat Anti-Mouse Secondary Antibody

A12003
  • EUR 232.26
  • EUR 117.70
  • 350 µg
  • 350 ug

Anti-Alpha-1-microglobulin protein antibody *Mouse anti-human, monoclonal IgG2b*

V100035 50 ug
EUR 367.2

Anti-Alpha-1-microglobulin protein antibody *Mouse anti-human, monoclonal IgG2b*

V100036 1 mg
EUR 367.2

Mouse Monoclonal Anti-Rat CD134, Biotin (Clone OX40) (mouse IgG2b)

RCD134-B 100 tests
EUR 562.8

Mouse Monoclonal Anti-Rat CD134, FITC (Clone OX40) (mouse IgG2b)

RCD134-F 100 tests
EUR 562.8

Mouse Monoclonal Anti-Rat CD134, Purified (Clone OX40) (mouse IgG2b)

RCD134-M 100 tests
EUR 578.4

Mouse Monoclonal Anti-Rat CD134, PE (Clone OX40) (mouse IgG2b)

RCD134-PE 100 tests
EUR 562.8

Mouse IgG2b

31C-CH1010 1 mg
EUR 438
Description: Purified Mouse IgG2b

Mouse IgG2b

C040309-10mg 10mg
EUR 2148

Mouse IgG2b

C040309-1mg 1mg
EUR 728.4

Anti-C-reactive protein antibody *Mouse anti-human, monoclonal IgG2b*

V100150 50 ug
EUR 367.2

Anti-C-reactive protein antibody *Mouse anti-human, monoclonal IgG2b*

V100151 1 mg
EUR 471.6

Anti-Follicle-stimulating hormone antibody *Mouse anti-human, monoclonal IgG2b*

V100175 50 ug
EUR 367.2

Anti-Follicle-stimulating hormone antibody *Mouse anti-human, monoclonal IgG2b*

V100176 1 mg
EUR 680.4

Rat Anti Mouse Igg2b Heavy Chain Monoclonal Antibody,Biotin

CABT-54634RM 0.5 mg
EUR 889.2

Rat Anti Mouse Igg2b Heavy Chain Monoclonal Antibody,FITC

CABT-54635RM 0.5 mg
EUR 889.2

Rabbit anti Mouse IgG2b (FITC)

43C-CB5135 1 mg
EUR 433.2
Description: Rabbit anti Mouse IgG2b secondary antibody (FITC)

Rabbit anti Mouse IgG2b (rhodamine)

43C-CB5136 1 mg
EUR 442.8
Description: Rabbit anti Mouse IgG2b secondary antibody (Rhodamine)

Rabbit anti Mouse IgG2b (biotin)

43C-CB5238 1 mg
EUR 441.6
Description: Rabbit anti Mouse IgG2b secondary antibody (biotin)

Mouse anti Rat IgG2b (HRP)

43R-1583 100 ug
EUR 338.4
Description: Mouse anti Rat IgG2b antibody (HRP)

Goat anti Mouse IgG2b (FITC)

43R-IG066ft 1 mg
EUR 289.2
Description: Goat anti Mouse IgG2b secondary antibody (FITC)

Rabbit anti Mouse IgG2b (HRP)

43r-IR032hrp 1 mg
EUR 500.4
Description: Rabbit anti Mouse IgG2b secondary antibody (HRP)

Goat anti-Mouse IgG2b Antibody

abx401480-05mg 0.5 mg
EUR 444

Mouse Monoclonal Anti-Mouse CD5 (Ly 1.2), Biotin (Clone CG16) (mouse IgG2b)

MCD005-B 100 tests
EUR 562.8

Mouse Monoclonal Anti-Mouse CD5 (Ly 1.2), FITC (Clone CG16) (mouse IgG2b)

MCD005-F 100 tests
EUR 562.8

Mouse Monoclonal Anti-Mouse CD5 (Ly 1.2), PE (Clone CG16) (mouse IgG2b)

MCD005-PE 100 tests
EUR 562.8

Anti-p16 (mouse monoclonal)

DB-253-1 1 ml
EUR 722.4
Description: rabbit monospecific clonal antibodies for ihc-p application; concentrated

Anti-Beta-2-microglobulin (B2M) antibody *Mouse anti-human, monoclonal IgG2b*

V100015 50 ug
EUR 367.2

Anti-Beta-2-microglobulin (B2M) antibody *Mouse anti-human, monoclonal IgG2b*

V100016 1 mg
EUR 471.6

Anti-Ferritin light chain (FER) antibody *Mouse anti-human, monoclonal IgG2b*

V100055 50 ug
EUR 367.2

Anti-Ferritin light chain (FER) antibody *Mouse anti-human, monoclonal IgG2b*

V100056 1 mg
EUR 367.2

Anti-Serum amyloid A protein antibody *Mouse anti-human, monoclonal IgG2b*

V100140 50 ug
EUR 367.2

Anti-Serum amyloid A protein antibody *Mouse anti-human, monoclonal IgG2b*

V100141 1 mg
EUR 471.6

Polyclonal Goat anti-GST α-form

GST-ANTI-1 50 uL
EUR 336

anti-CD54 IgG2b-k monoclonal antibody

068-A-01mg 0,1 mg
EUR 321
Description: anti-CD54 IgG2b-k monoclonal antibody

anti-CD54 IgG2b-k monoclonal antibody

068-A-1000ug 1000 ug
EUR 1539
Description: anti-CD54 IgG2b-k monoclonal antibody

Mouse Monoclonal Anti-Mouse CD5 (Ly 1.2), No Azide (Clone CG16) (mouse IgG2b)

MCD005-M 100 Tests
EUR 578.4

Mouse IgG2b (FITC)

65C-CH1011 100 µg
EUR 271.2
Description: Purified Mouse IgG2b FITC conjugate

Mouse IgG2b (HRP)

65C-CH1022 100 µg
EUR 309.6
Description: Purified Mouse IgG2b HRP conjugate

Mouse IgG2b protein

31R-1084 1 mg
EUR 308.4
Description: Purified native Mouse IgG2b protein

Mouse IgG2b Antibody

41R-1127 1 mg
EUR 477.6
Description: Goat anti-Mouse IgG2b Antibody

Mouse IgG2b Control

ICIGG2BA-50 50 µg
EUR 387.6

Mouse IgG2b Control

ICIGG2BCFB-100 100 µg
EUR 387.6

Mouse IgG2b Control

ICIGG2BF-100 100 µg
EUR 239.4

Mouse IgG2b Control

ICIGG2BPE-50 50 µg
EUR 387.6

Mouse IgG2b Control

ICIGG2BPP-100 100 µg
EUR 387.6

Mouse IgG2b Control

ICIGG2BPP5.5-100 100 µg
EUR 387.6

Mouse IgG2b Control

ICIGG2BPU-100 100 µg
EUR 239.4

Mouse IgG2b Antibody

R20167-100UG 100ug
EUR 409

Mouse IgG2b Antibody

R20167BTN-50UG 50ug
EUR 409

Mouse IgG2b Antibody

R20167SAF-250UG 250ug
EUR 979

Anti-Dnmt3a (mouse) Monoclonal Antibody (64B1446)

M00136-1 100ug
EUR 535.2
Description: Mouse Monoclonal Dnmt3a (mouse) Antibody (64B1446). Validated in IP, IF, IHC, WB and tested in Mouse.

Monoclonal antibody for Ataxin 1

SMC-455D 0.1mg
EUR 423.6
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical). . The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is not conjugated.

Monoclonal antibody for Ataxin 1

SMC-455D-A390 0.1mg
EUR 480
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical). . The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with ATTO 390.

Monoclonal antibody for Ataxin 1

SMC-455D-A488 0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical). . The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with ATTO 488.

Monoclonal antibody for Ataxin 1

SMC-455D-A565 0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical). . The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with ATTO 565.

Monoclonal antibody for Ataxin 1

SMC-455D-A594 0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical). . The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with ATTO 594.

Monoclonal antibody for Ataxin 1

SMC-455D-A633 0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical). . The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with ATTO 633.

Monoclonal antibody for Ataxin 1

SMC-455D-A655 0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical). . The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with ATTO 655.

Monoclonal antibody for Ataxin 1

SMC-455D-A680 0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical). . The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with ATTO 680.

Monoclonal antibody for Ataxin 1

SMC-455D-A700 0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical). . The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with ATTO 700.

Monoclonal antibody for Ataxin 1

SMC-455D-ALP 0.1mg
EUR 471.6
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical). . The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with Alkaline Phosphatase.

Monoclonal antibody for Ataxin 1

SMC-455D-APC 0.1mg
EUR 477.6
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical). . The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with APC.

Monoclonal antibody for Ataxin 1

SMC-455D-APCCY7 0.1mg
EUR 564
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical). . The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with APC/Cy7.

Monoclonal antibody for Ataxin 1

SMC-455D-BI 0.1mg
EUR 474
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical). . The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with Biotin.

Monoclonal antibody for Ataxin 1

SMC-455D-DY350 0.1mg
EUR 495.6
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical). . The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with Dylight 350.

Monoclonal antibody for Ataxin 1

SMC-455D-DY405 0.1mg
EUR 482.4
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical). . The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with Dylight 405.

Monoclonal antibody for Ataxin 1

SMC-455D-DY488 0.1mg
EUR 470.4
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical). . The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with Dylight 488.

Monoclonal antibody for Ataxin 1

SMC-455D-DY594 0.1mg
EUR 472.8
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical). . The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with Dylight 594.

Monoclonal antibody for Ataxin 1

SMC-455D-DY633 0.1mg
EUR 466.8
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical). . The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with Dylight 633.

Monoclonal antibody for Ataxin 1

SMC-455D-FITC 0.1mg
EUR 469.2
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical). . The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with FITC.

Monoclonal antibody for Ataxin 1

SMC-455D-HRP 0.1mg
EUR 464.4
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical). . The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with HRP.

Monoclonal antibody for Ataxin 1

SMC-455D-P594 0.1mg
EUR 487.2
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical). . The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with PE/ATTO 594.

Monoclonal antibody for Ataxin 1

SMC-455D-PCP 0.1mg
EUR 477.6
Description: A monoclonal antibody from clone S76-8 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical). . The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with PerCP.

Monoclonal antibody for Ataxin 1

SMC-455D-RPE 0.1mg
EUR 475.2
Description: A monoclonal antibody from clone S76-8 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical). . The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with RPE.

Monoclonal antibody for Ataxin 1

SMC-455D-STR 0.1mg
EUR 476.4
Description: A monoclonal antibody from clone S76-8 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical). . The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with Streptavidin.

Monoclonal antibody for Ataxin 1

SMC-455S 0.012mg
EUR 78
Description: A monoclonal antibody from clone S76-8 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical). . The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is not conjugated.

Monoclonal antibody for Ataxin 1

SMC-475D 0.1mg
EUR 423.6
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical). . The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is not conjugated.

Monoclonal antibody for Ataxin 1

SMC-475D-A390 0.1mg
EUR 480
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical). . The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with ATTO 390.

Monoclonal antibody for Ataxin 1

SMC-475D-A488 0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical). . The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with ATTO 488.

Monoclonal antibody for Ataxin 1

SMC-475D-A565 0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical). . The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with ATTO 565.

Monoclonal antibody for Ataxin 1

SMC-475D-A594 0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical). . The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with ATTO 594.

Monoclonal antibody for Ataxin 1

SMC-475D-A633 0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical). . The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with ATTO 633.

Monoclonal antibody for Ataxin 1

SMC-475D-A655 0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical). . The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with ATTO 655.

Monoclonal antibody for Ataxin 1

SMC-475D-A680 0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical). . The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with ATTO 680.

Monoclonal antibody for Ataxin 1

SMC-475D-A700 0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical). . The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with ATTO 700.
Moreover, built-in stress response activation enhances SCA3 RAN translation. Our findings recommend that the ATXN3 sequence context performs an necessary function in triggering SCA3 RAN translation and that SCA3 RAN proteins might trigger mobile toxicity.

Leave a Reply

Your email address will not be published.