New alternative splicing variants of the ATXN2 transcript

Background: Spinocerebellar ataxia sort 2 (SCA2) is an autosomal dominant dysfunction with progressive degeneration of cerebellar Purkinje cells and selective lack of neurons within the brainstem. This neurodegenerative dysfunction is attributable to the enlargement of a polyglutamine area in ataxin-2. Ataxin-2 consists of 1312 amino acids, has a predicted molecular weight of 150-kDa and is extensively expressed in neuronal and non-neuronal tissues. Up to now, the putative features of ataxin-2 on mRNA translation and endocytosis stay ill-defined. Differential splicing with a scarcity of exons 10 and 21 was described in people, and extra splicing of exon 11 in mice. On this research, we noticed that the molecular dimension of transfected full-length wild-type ataxin-2 (22 glutamines) is completely different from endogenous ataxin-2 and that this variation couldn’t be defined by the beforehand printed splice variants alone.

Strategies: Quantitative immunoblots and qualitative reverse-transcriptase polymerase-chain-reaction (RT-PCR) have been used to characterize isoform variants, earlier than sequencing was employed for validation.

Outcomes: We report the characterization of additional splice variants of ataxin-2 in numerous human cell traces and in mouse and human mind. Utilizing RT-PCR from cell traces HeLa, HEK293 and COS-7 all through the open studying body of ataxin-2 along with PCR-sequencing, we discovered novel splice variants missing exon 12 and exon 24. These findings have been corroborated in murine and human mind. The splice variants have been additionally present in human pores and skin fibroblasts from SCA2 sufferers and controls, indicating that the polyglutamine enlargement doesn’t abolish the splicing.

Conclusions: Provided that Ataxin-2 interacts with essential splice modulators comparable to TDP-43 and modulates the danger of Amyotrophic Lateral Sclerosis, its personal splice isoforms might turn out to be related in mind tissue to watch the RNA processing throughout illness development and neuroprotective remedy.

Machado-Joseph illness (MJD), also referred to as spinocerebellar ataxia sort 3 (SCA3), is the commonest type of dominantly inherited ataxia worldwide. This illness is attributable to an expanded CAG repeat within the coding area of ATXN3. As a consequence of our incomplete understanding of mechanisms and molecular pathways associated to this illness, there aren’t any therapies that efficiently deal with core MJD sufferers. Due to this fact, the identification of recent candidate targets associated to this illness is required. On this research, we carried out a large-scale RNA interference (RNAi) display screen of 387 transcription issue genes resulting in the identification of a number of modifiers (suppressors and enhancers) of impaired motility phenotypes in a mutant ATXN3 transgenic C. elegans mannequin. We confirmed that inactivation of 1 explicit gene, fkh-2/FOXG1, enhanced the motility defect, neurodegeneration and diminished longevity in our MJD fashions.

Reverse to genetic inactivation, the overexpression of fkh-2 rescued the impaired motility, shortened-lifespan, and neurodegeneration phenotypes of mutant ATXN3 transgenics. We discovered that overexpression of mutant worms is neuroprotective. Utilizing our transgenic ATXN3 C. elegans fashions and the screening of an RNAi library, we gained insights into the pathways contributing to neurodegeneration, and located that has neuroprotective exercise. These findings might assist the event of novel therapeutic interventions for MJD. Enlargement of a CAG repeat in ATXN3 causes the dominant polyglutamine illness spinocerebellar ataxia sort 3 (SCA3), but the physiological function of ATXN3 stays unclear.

Right here, we concentrate on unveiling the perform of Ataxin-3  within the retina, a neurological organ amenable to morphological and physiological research. Depletion of Atxn3 in zebrafish and mice causes morphological and practical retinal alterations and, extra exactly, photoreceptor cilium and outer section elongation, cone opsin mislocalization, and cone hyperexcitation. ATXN3 localizes on the basal physique and axoneme of the cilium, supporting its function in regulating ciliary size.

Spinocerebellar ataxia sort 3 (SCA3) is a progressive neurodegenerative dysfunction attributable to a CAG repeat enlargement within the ATXN3 gene encoding the ataxin-Three protein. Regardless of intensive analysis the precise pathogenic mechanisms of SCA3 are nonetheless not understood in depth. Within the current research, to realize perception into the toxicity induced by the expanded CAG repeats in SCA3, we comprehensively investigated repeat-associated non-ATG (RAN) translation in numerous mobile fashions expressing translated or non-canonically translated ATXN3 sequences with an growing variety of CAG repeats.

We display that two SCA3 RAN proteins, polyglutamine (polyQ) and polyalanine (polyA), are discovered solely within the case of CAG repeats of pathogenic size. Regardless of having distinct mobile localization, RAN polyQ and RAN polyA proteins are fairly often coexpressed in the identical cell, impairing nuclear integrity and inducing apoptosis. We offer for the primary time mechanistic insights into SCA3 RAN translation indicating that ATXN3 sequences surrounding the repeat area have an effect on SCA3 RAN translation initiation and effectivity. We revealed that RAN translation of polyQ proteins begins at non-cognate codons upstream of the CAG repeats, whereas RAN polyA proteins are seemingly translated inside repeats.

Anti-Ofloxacin antibody *Mouse anti-human, monoclonal IgG2b*
V100235	AAT Bioquest	50 ug	EUR 306

Anti-Ofloxacin antibody *Mouse anti-human, monoclonal IgG2b*
V100236	AAT Bioquest	1 mg	EUR 1089

Anti-Enrofloxacin antibody *Mouse anti-human, monoclonal IgG2b*
V100260	AAT Bioquest	50 ug	EUR 306

Anti-Enrofloxacin antibody *Mouse anti-human, monoclonal IgG2b*
V100261	AAT Bioquest	1 mg	EUR 1089

Anti-Mouse IgG2b antibody
STJ16100634	St John's Laboratory	1 mL	EUR 704

Anti-Mouse IgG2b antibody
STJ16100635	St John's Laboratory	1 mL	EUR 858

Anti-Mouse IgG2b antibody
STJ16100636	St John's Laboratory	1 mL	EUR 871

Anti-Mouse IgG2b antibody
STJ16100637	St John's Laboratory	1 mL	EUR 1489

Goat anti Mouse IgG2b
FNSA-0088	FN Test	500 uL	EUR 306.6
Description: Goat anti Mouse IgG2b secondary antibody

Rabbit anti Mouse IgG2b
40C-CB5134	Fitzgerald	1 mg	EUR 340
Description: Rabbit anti Mouse IgG2b secondary antibody

Mouse anti Rat IgG2b
41R-1119	Fitzgerald	100 ug	EUR 265
Description: Mouse anti Rat IgG2b secondary antibody

Anti-Myeloperoxidase (MPO) antibody *Mouse anti-human, monoclonal IgG2b*
V100095	AAT Bioquest	50 ug	EUR 306

Anti-Myeloperoxidase (MPO) antibody *Mouse anti-human, monoclonal IgG2b*
V100096	AAT Bioquest	1 mg	EUR 741

Anti-Procalcitonin (PCT) antibody *Mouse anti-human, monoclonal IgG2b*
V100115	AAT Bioquest	50 ug	EUR 306

Anti-Procalcitonin (PCT) antibody *Mouse anti-human, monoclonal IgG2b*
V100116	AAT Bioquest	1 mg	EUR 393

Anti-Prolactin (PRL) antibody *Mouse anti-human, monoclonal IgG2b*
V100160	AAT Bioquest	50 ug	EUR 306

Anti-Prolactin (PRL) antibody *Mouse anti-human, monoclonal IgG2b*
V100161	AAT Bioquest	1 mg	EUR 393

Anti-Folic acid antibody *Mouse anti-human, monoclonal IgG2b*
V100200	AAT Bioquest	50 ug	EUR 306

Anti-Folic acid antibody *Mouse anti-human, monoclonal IgG2b*
V100201	AAT Bioquest	1 mg	EUR 741

Anti-Chenodeoxycholic acid antibody *Mouse anti-human, monoclonal IgG2b*
V100225	AAT Bioquest	50 ug	EUR 306

Anti-Chenodeoxycholic acid antibody *Mouse anti-human, monoclonal IgG2b*
V100226	AAT Bioquest	1 mg	EUR 741

Anti-Alpha-1-microglobulin protein antibody *Mouse anti-human, monoclonal IgG2b*
V100035	AAT Bioquest	50 ug	EUR 306

Anti-Alpha-1-microglobulin protein antibody *Mouse anti-human, monoclonal IgG2b*
V100036	AAT Bioquest	1 mg	EUR 306

CF350 Goat Anti-Mouse IgG2b (γ2b), 2mg/mL
20265-1	Biotium	50uL	EUR 149
Description: Minimum order quantity: 1 unit of 50uL

CF488A Goat Anti-Mouse IgG2b (γ2b), 2mg/mL
20266-1	Biotium	50uL	EUR 149
Description: Minimum order quantity: 1 unit of 50uL

CF555 Goat Anti-Mouse IgG2b (γ2b), 2mg/mL
20267-1	Biotium	50uL	EUR 149
Description: Minimum order quantity: 1 unit of 50uL

CF568 Goat Anti-Mouse IgG2b (γ2b), 2mg/mL
20268-1	Biotium	50uL	EUR 149
Description: Minimum order quantity: 1 unit of 50uL

CF594 Goat Anti-Mouse IgG2b (γ2b), 2mg/mL
20269-1	Biotium	50uL	EUR 149
Description: Minimum order quantity: 1 unit of 50uL

CF633 Goat Anti-Mouse IgG2b (γ2b), 2mg/mL
20270-1	Biotium	50uL	EUR 149
Description: Minimum order quantity: 1 unit of 50uL

CF640R Goat Anti-Mouse IgG2b (γ2b), 2mg/mL
20271-1	Biotium	50uL	EUR 149
Description: Minimum order quantity: 1 unit of 50uL

CF647 Goat Anti-Mouse IgG2b (γ2b), 2mg/mL
20272-1	Biotium	50uL	EUR 149
Description: Minimum order quantity: 1 unit of 50uL

CF680 Goat Anti-Mouse IgG2b (γ2b), 2mg/mL
20273-1	Biotium	50uL	EUR 161
Description: Minimum order quantity: 1 unit of 50uL

CF770 Goat Anti-Mouse IgG2b (γ2b), 2mg/mL
20274-1	Biotium	50uL	EUR 161
Description: Minimum order quantity: 1 unit of 50uL

CF543 Goat Anti-Mouse IgG2b (γ2b), 2mg/mL
20327-1	Biotium	50uL	EUR 149
Description: Minimum order quantity: 1 unit of 50uL

Anti-Mouse IgG2b Rabbit Monoclonal Antibody, Clone#RM108
M33092	BosterBio	100ug	EUR 375
Description: Anti-Mouse IgG2b Rabbit Monoclonal Antibody, Clone#RM108 tested in WB (stronger on nonreduced), IP, ICC, IHC, FC, ELISA , reactive to Mouse

Mouse Anti-Ovalbumin IgG2b Monoclonal Antibody, Clone 4B4E6
7096	Chondrex	1 mg/ml x 0.1 ml	EUR 338.55
Description: Mouse Anti-Ovalbumin IgG2b Monoclonal Antibody

Mouse Anti-SEB IgG2b Monoclonal Antibody, Clone 5D12C9
7105	Chondrex	1 mg/ml x 0.1 ml	EUR 482.1
Description: Mouse Anti-SEB IgG2b Monoclonal Antibody

Mouse Anti-SEA IgG2b Monoclonal Antibody, Clone 1E10G12
7108	Chondrex	1 mg/ml x 0.1 ml	EUR 482.1
Description: Mouse Anti-SEA IgG2b Monoclonal Antibody

Mouse Anti-HDM IgG2b Monoclonal Antibody, Clone 3C4H2
7112	Chondrex	1 mg/ml x 0.1 ml	EUR 338.55
Description: Mouse Anti-HDM IgG2b Monoclonal Antibody

Mouse Anti-Ro60 IgG2b Monoclonal Antibody, Clone 2D6E12
7125	Chondrex	1 mg/ml x 0.1 ml	EUR 338.55
Description: Mouse Anti-Ro60 IgG2b Monoclonal Antibody

Mouse Monoclonal Anti-Rat CD134, Biotin (Clone OX40) (mouse IgG2b)
RCD134-B	Alpha Diagnostics	100 tests	EUR 469

Mouse Monoclonal Anti-Rat CD134, FITC (Clone OX40) (mouse IgG2b)
RCD134-F	Alpha Diagnostics	100 tests	EUR 469

Mouse Monoclonal Anti-Rat CD134, Purified (Clone OX40) (mouse IgG2b)
RCD134-M	Alpha Diagnostics	100 tests	EUR 482

Mouse Monoclonal Anti-Rat CD134, PE (Clone OX40) (mouse IgG2b)
RCD134-PE	Alpha Diagnostics	100 tests	EUR 469

Mouse IgG2b
C040309-10mg	Unibiotest	10mg	EUR 1790

Mouse IgG2b
C040309-1mg	Unibiotest	1mg	EUR 607

Mouse IgG2b
31C-CH1010	Fitzgerald	1 mg	EUR 365
Description: Purified Mouse IgG2b

Anti-C-reactive protein antibody *Mouse anti-human, monoclonal IgG2b*
V100150	AAT Bioquest	50 ug	EUR 306

Anti-C-reactive protein antibody *Mouse anti-human, monoclonal IgG2b*
V100151	AAT Bioquest	1 mg	EUR 393

Anti-Follicle-stimulating hormone antibody *Mouse anti-human, monoclonal IgG2b*
V100175	AAT Bioquest	50 ug	EUR 306

Anti-Follicle-stimulating hormone antibody *Mouse anti-human, monoclonal IgG2b*
V100176	AAT Bioquest	1 mg	EUR 567

Rat Anti Mouse Igg2b Heavy Chain Monoclonal Antibody,Biotin
CABT-54634RM	Creative Diagnostics	0.5 mg	EUR 741

Rat Anti Mouse Igg2b Heavy Chain Monoclonal Antibody,FITC
CABT-54635RM	Creative Diagnostics	0.5 mg	EUR 741

Goat anti-Mouse IgG2b Antibody
abx401480-05mg	Abbexa	0.5 mg	EUR 370

Rabbit anti Mouse IgG2b (FITC)
43C-CB5135	Fitzgerald	1 mg	EUR 361
Description: Rabbit anti Mouse IgG2b secondary antibody (FITC)

Rabbit anti Mouse IgG2b (rhodamine)
43C-CB5136	Fitzgerald	1 mg	EUR 369
Description: Rabbit anti Mouse IgG2b secondary antibody (Rhodamine)

Rabbit anti Mouse IgG2b (biotin)
43C-CB5238	Fitzgerald	1 mg	EUR 368
Description: Rabbit anti Mouse IgG2b secondary antibody (biotin)

Mouse anti Rat IgG2b (HRP)
43R-1583	Fitzgerald	100 ug	EUR 282
Description: Mouse anti Rat IgG2b antibody (HRP)

Goat anti Mouse IgG2b (FITC)
43R-IG066ft	Fitzgerald	1 mg	EUR 241
Description: Goat anti Mouse IgG2b secondary antibody (FITC)

Rabbit anti Mouse IgG2b (HRP)
43r-IR032hrp	Fitzgerald	1 mg	EUR 417
Description: Rabbit anti Mouse IgG2b secondary antibody (HRP)

Anti-p16 (mouse monoclonal)
DB-253-1	DB Biotech	1 ml	EUR 602
Description: rabbit monospecific clonal antibodies for ihc-p application; concentrated

Mouse Monoclonal Anti-Mouse CD5 (Ly 1.2), Biotin (Clone CG16) (mouse IgG2b)
MCD005-B	Alpha Diagnostics	100 tests	EUR 469

Mouse Monoclonal Anti-Mouse CD5 (Ly 1.2), FITC (Clone CG16) (mouse IgG2b)
MCD005-F	Alpha Diagnostics	100 tests	EUR 469

Mouse Monoclonal Anti-Mouse CD5 (Ly 1.2), PE (Clone CG16) (mouse IgG2b)
MCD005-PE	Alpha Diagnostics	100 tests	EUR 469

Anti-Beta-2-microglobulin (B2M) antibody *Mouse anti-human, monoclonal IgG2b*
V100015	AAT Bioquest	50 ug	EUR 306

Anti-Beta-2-microglobulin (B2M) antibody *Mouse anti-human, monoclonal IgG2b*
V100016	AAT Bioquest	1 mg	EUR 393

Anti-Ferritin light chain (FER) antibody *Mouse anti-human, monoclonal IgG2b*
V100055	AAT Bioquest	50 ug	EUR 306

Anti-Ferritin light chain (FER) antibody *Mouse anti-human, monoclonal IgG2b*
V100056	AAT Bioquest	1 mg	EUR 306

Anti-Serum amyloid A protein antibody *Mouse anti-human, monoclonal IgG2b*
V100140	AAT Bioquest	50 ug	EUR 306

Anti-Serum amyloid A protein antibody *Mouse anti-human, monoclonal IgG2b*
V100141	AAT Bioquest	1 mg	EUR 393

anti-CD54 IgG2b-k monoclonal antibody
068-A-01mg	Virogen	0,1 mg	EUR 267.5
Description: anti-CD54 IgG2b-k monoclonal antibody

anti-CD54 IgG2b-k monoclonal antibody
068-A-1000ug	Virogen	1000 ug	EUR 1282.5
Description: anti-CD54 IgG2b-k monoclonal antibody

Polyclonal Goat anti-GST α-form
GST-ANTI-1	Detroit R&D	50 uL	EUR 280

Mouse Monoclonal Anti-Mouse CD5 (Ly 1.2), No Azide (Clone CG16) (mouse IgG2b)
MCD005-M	Alpha Diagnostics	100 Tests	EUR 482

Anti-Dnmt3a (mouse) Monoclonal Antibody (64B1446)
M00136-1	BosterBio	100ug	EUR 446
Description: Mouse Monoclonal Dnmt3a (mouse) Antibody (64B1446). Validated in IP, IF, IHC, WB and tested in Mouse.

Monoclonal antibody for Ataxin 1
SMC-455D	Stressmarq	0.1mg	EUR 353
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical). . The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is not conjugated.

Monoclonal antibody for Ataxin 1
SMC-455D-A390	Stressmarq	0.1mg	EUR 400
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical). . The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with ATTO 390.

Monoclonal antibody for Ataxin 1
SMC-455D-A488	Stressmarq	0.1mg	EUR 399
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical). . The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with ATTO 488.

Monoclonal antibody for Ataxin 1
SMC-455D-A565	Stressmarq	0.1mg	EUR 399
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical). . The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with ATTO 565.

Monoclonal antibody for Ataxin 1
SMC-455D-A594	Stressmarq	0.1mg	EUR 399
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical). . The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with ATTO 594.

Monoclonal antibody for Ataxin 1
SMC-455D-A633	Stressmarq	0.1mg	EUR 399
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical). . The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with ATTO 633.

Monoclonal antibody for Ataxin 1
SMC-455D-A655	Stressmarq	0.1mg	EUR 399
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical). . The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with ATTO 655.

Monoclonal antibody for Ataxin 1
SMC-455D-A680	Stressmarq	0.1mg	EUR 399
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical). . The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with ATTO 680.

Monoclonal antibody for Ataxin 1
SMC-455D-A700	Stressmarq	0.1mg	EUR 399
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical). . The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with ATTO 700.

Monoclonal antibody for Ataxin 1
SMC-455D-ALP	Stressmarq	0.1mg	EUR 393
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical). . The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with Alkaline Phosphatase.

Monoclonal antibody for Ataxin 1
SMC-455D-APC	Stressmarq	0.1mg	EUR 398
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical). . The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with APC.

Monoclonal antibody for Ataxin 1
SMC-455D-APCCY7	Stressmarq	0.1mg	EUR 470
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical). . The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with APC/Cy7.

Monoclonal antibody for Ataxin 1
SMC-455D-BI	Stressmarq	0.1mg	EUR 395
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical). . The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with Biotin.

Monoclonal antibody for Ataxin 1
SMC-455D-DY350	Stressmarq	0.1mg	EUR 413
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical). . The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with Dylight 350.

Monoclonal antibody for Ataxin 1
SMC-455D-DY405	Stressmarq	0.1mg	EUR 402
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical). . The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with Dylight 405.

Monoclonal antibody for Ataxin 1
SMC-455D-DY488	Stressmarq	0.1mg	EUR 392
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical). . The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with Dylight 488.

Monoclonal antibody for Ataxin 1
SMC-455D-DY594	Stressmarq	0.1mg	EUR 394
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical). . The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with Dylight 594.

Monoclonal antibody for Ataxin 1
SMC-455D-DY633	Stressmarq	0.1mg	EUR 389
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical). . The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with Dylight 633.

Monoclonal antibody for Ataxin 1
SMC-455D-FITC	Stressmarq	0.1mg	EUR 391
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical). . The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with FITC.

Monoclonal antibody for Ataxin 1
SMC-455D-HRP	Stressmarq	0.1mg	EUR 387
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical). . The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with HRP.

Monoclonal antibody for Ataxin 1
SMC-455D-P594	Stressmarq	0.1mg	EUR 406
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical). . The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with PE/ATTO 594.

Monoclonal antibody for Ataxin 1
SMC-455D-PCP	Stressmarq	0.1mg	EUR 398
Description: A monoclonal antibody from clone S76-8 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical). . The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with PerCP.

Monoclonal antibody for Ataxin 1
SMC-455D-RPE	Stressmarq	0.1mg	EUR 396
Description: A monoclonal antibody from clone S76-8 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical). . The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with RPE.

Monoclonal antibody for Ataxin 1
SMC-455D-STR	Stressmarq	0.1mg	EUR 397
Description: A monoclonal antibody from clone S76-8 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical). . The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with Streptavidin.

Monoclonal antibody for Ataxin 1
SMC-455S	Stressmarq	0.012mg	EUR 65
Description: A monoclonal antibody from clone S76-8 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical). . The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is not conjugated.

Monoclonal antibody for Ataxin 1
SMC-475D	Stressmarq	0.1mg	EUR 353
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical). . The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is not conjugated.

Monoclonal antibody for Ataxin 1
SMC-475D-A390	Stressmarq	0.1mg	EUR 400
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical). . The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with ATTO 390.

Monoclonal antibody for Ataxin 1
SMC-475D-A488	Stressmarq	0.1mg	EUR 399
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical). . The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with ATTO 488.

Monoclonal antibody for Ataxin 1
SMC-475D-A565	Stressmarq	0.1mg	EUR 399
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical). . The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with ATTO 565.

Monoclonal antibody for Ataxin 1
SMC-475D-A594	Stressmarq	0.1mg	EUR 399
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical). . The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with ATTO 594.

Monoclonal antibody for Ataxin 1
SMC-475D-A633	Stressmarq	0.1mg	EUR 399
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical). . The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with ATTO 633.

Monoclonal antibody for Ataxin 1
SMC-475D-A655	Stressmarq	0.1mg	EUR 399
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical). . The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with ATTO 655.

Monoclonal antibody for Ataxin 1
SMC-475D-A680	Stressmarq	0.1mg	EUR 399
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical). . The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with ATTO 680.

Monoclonal antibody for Ataxin 1
SMC-475D-A700	Stressmarq	0.1mg	EUR 399
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical). . The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with ATTO 700.

Monoclonal antibody for Ataxin 1
SMC-475D-ALP	Stressmarq	0.1mg	EUR 393
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical). . The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with Alkaline Phosphatase.

Monoclonal antibody for Ataxin 1
SMC-475D-APC	Stressmarq	0.1mg	EUR 398
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical). . The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with APC.

Monoclonal antibody for Ataxin 1
SMC-475D-APCCY7	Stressmarq	0.1mg	EUR 470
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical). . The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with APC/Cy7.

Monoclonal antibody for Ataxin 1
SMC-475D-BI	Stressmarq	0.1mg	EUR 395
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical). . The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with Biotin.

Monoclonal antibody for Ataxin 1
SMC-475D-DY350	Stressmarq	0.1mg	EUR 413
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical). . The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with Dylight 350.

Monoclonal antibody for Ataxin 1
SMC-475D-DY405	Stressmarq	0.1mg	EUR 402
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical). . The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with Dylight 405.

Monoclonal antibody for Ataxin 1
SMC-475D-DY488	Stressmarq	0.1mg	EUR 392
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical). . The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with Dylight 488.

Monoclonal antibody for Ataxin 1
SMC-475D-DY594	Stressmarq	0.1mg	EUR 394
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical). . The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with Dylight 594.

Monoclonal antibody for Ataxin 1
SMC-475D-DY633	Stressmarq	0.1mg	EUR 389
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical). . The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with Dylight 633.

Monoclonal antibody for Ataxin 1
SMC-475D-FITC	Stressmarq	0.1mg	EUR 391
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical). . The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with FITC.

Monoclonal antibody for Ataxin 1
SMC-475D-HRP	Stressmarq	0.1mg	EUR 387
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical). . The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with HRP.

Monoclonal antibody for Ataxin 1
SMC-475D-P594	Stressmarq	0.1mg	EUR 406
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical). . The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with PE/ATTO 594.

Monoclonal antibody for Ataxin 1
SMC-475D-PCP	Stressmarq	0.1mg	EUR 398
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical). . The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with PerCP.

Monoclonal antibody for Ataxin 1
SMC-475D-RPE	Stressmarq	0.1mg	EUR 396
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical). . The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with RPE.

Monoclonal antibody for Ataxin 1
SMC-475D-STR	Stressmarq	0.1mg	EUR 397
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical). . The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with Streptavidin.

Moreover, built-in stress response activation enhances SCA3 RAN translation. Our findings recommend that the ATXN3 sequence context performs an necessary function in triggering SCA3 RAN translation and that SCA3 RAN proteins might trigger mobile toxicity.