New alternative splicing variants of the ATXN2 transcript

New alternative splicing variants of the ATXN2 transcript
Background: Spinocerebellar ataxia sort 2 (SCA2) is an autosomal dominant dysfunction with progressive degeneration of cerebellar Purkinje cells and selective lack of neurons within the brainstem. This neurodegenerative dysfunction is attributable to the enlargement of a polyglutamine area in ataxin-2. Ataxin-2 consists of 1312 amino acids, has a predicted molecular weight of 150-kDa and is extensively expressed in neuronal and non-neuronal tissues. Up to now, the putative features of ataxin-2 on mRNA translation and endocytosis stay ill-defined. Differential splicing with a scarcity of exons 10 and 21 was described in people, and extra splicing of exon 11 in mice. On this research, we noticed that the molecular dimension of transfected full-length wild-type ataxin-2 (22 glutamines) is completely different from endogenous ataxin-2 and that this variation couldn’t be defined by the beforehand printed splice variants alone.
Strategies: Quantitative immunoblots and qualitative reverse-transcriptase polymerase-chain-reaction (RT-PCR) have been used to characterize isoform variants, earlier than sequencing was employed for validation.
Outcomes: We report the characterization of additional splice variants of ataxin-2 in numerous human cell traces and in mouse and human mind. Utilizing RT-PCR from cell traces HeLa, HEK293 and COS-7 all through the open studying body of ataxin-2 along with PCR-sequencing, we discovered novel splice variants missing exon 12 and exon 24. These findings have been corroborated in murine and human mind. The splice variants have been additionally present in human pores and skin fibroblasts from SCA2 sufferers and controls, indicating that the polyglutamine enlargement doesn’t abolish the splicing.
Conclusions: Provided that Ataxin-2 interacts with essential splice modulators comparable to TDP-43 and modulates the danger of Amyotrophic Lateral Sclerosis, its personal splice isoforms might turn out to be related in mind tissue to watch the RNA processing throughout illness development and neuroprotective remedy.

Overexpression of FKH-2/FOXG1 is neuroprotective in a C. elegans mannequin of Machado-Joseph illness

Machado-Joseph illness (MJD), also referred to as spinocerebellar ataxia sort 3 (SCA3), is the commonest type of dominantly inherited ataxia worldwide. This illness is attributable to an expanded CAG repeat within the coding area of ATXN3. As a consequence of our incomplete understanding of mechanisms and molecular pathways associated to this illness, there aren’t any therapies that efficiently deal with core MJD sufferers. Due to this fact, the identification of recent candidate targets associated to this illness is required. On this research, we carried out a large-scale RNA interference (RNAi) display screen of 387 transcription issue genes resulting in the identification of a number of modifiers (suppressors and enhancers) of impaired motility phenotypes in a mutant ATXN3 transgenic C. elegans mannequin. We confirmed that inactivation of 1 explicit gene, fkh-2/FOXG1, enhanced the motility defect, neurodegeneration and diminished longevity in our MJD fashions.
Reverse to genetic inactivation, the overexpression of fkh-2 rescued the impaired motility, shortened-lifespan, and neurodegeneration phenotypes of mutant ATXN3 transgenics. We discovered that overexpression of mutant worms is neuroprotective. Utilizing our transgenic ATXN3 C. elegans fashions and the screening of an RNAi library, we gained insights into the pathways contributing to neurodegeneration, and located that has neuroprotective exercise. These findings might assist the event of novel therapeutic interventions for MJD. Enlargement of a CAG repeat in ATXN3 causes the dominant polyglutamine illness spinocerebellar ataxia sort 3 (SCA3), but the physiological function of ATXN3 stays unclear.
Right here, we concentrate on unveiling the perform of Ataxin-3  within the retina, a neurological organ amenable to morphological and physiological research. Depletion of Atxn3 in zebrafish and mice causes morphological and practical retinal alterations and, extra exactly, photoreceptor cilium and outer section elongation, cone opsin mislocalization, and cone hyperexcitation. ATXN3 localizes on the basal physique and axoneme of the cilium, supporting its function in regulating ciliary size.
New alternative splicing variants of the ATXN2 transcript

New alternative splicing variants of the ATXN2 transcript

RAN translation of the expanded CAG repeats within the SCA3 illness context

Spinocerebellar ataxia sort 3 (SCA3) is a progressive neurodegenerative dysfunction attributable to a CAG repeat enlargement within the ATXN3 gene encoding the ataxin-Three protein. Regardless of intensive analysis the precise pathogenic mechanisms of SCA3 are nonetheless not understood in depth. Within the current research, to realize perception into the toxicity induced by the expanded CAG repeats in SCA3, we comprehensively investigated repeat-associated non-ATG (RAN) translation in numerous mobile fashions expressing translated or non-canonically translated ATXN3 sequences with an growing variety of CAG repeats.
We display that two SCA3 RAN proteins, polyglutamine (polyQ) and polyalanine (polyA), are discovered solely within the case of CAG repeats of pathogenic size. Regardless of having distinct mobile localization, RAN polyQ and RAN polyA proteins are fairly often coexpressed in the identical cell, impairing nuclear integrity and inducing apoptosis. We offer for the primary time mechanistic insights into SCA3 RAN translation indicating that ATXN3 sequences surrounding the repeat area have an effect on SCA3 RAN translation initiation and effectivity. We revealed that RAN translation of polyQ proteins begins at non-cognate codons upstream of the CAG repeats, whereas RAN polyA proteins are seemingly translated inside repeats.

Mouse Anti-Rat GluN2B/NR2B Monoclonal IgG2b
MBS800075-01mg 0.1mg
EUR 435

Mouse Anti-Rat GluN2B/NR2B Monoclonal IgG2b
MBS800075-5x01mg 5x0.1mg
EUR 1700

Mouse Anti-Human Ankyrin R Monoclonal IgG2B
MBS807322-01mg 0.1mg
EUR 480

Mouse Anti-Human Ankyrin R Monoclonal IgG2B
MBS807322-5x01mg 5x0.1mg
EUR 1905

Mouse Anti-Human Ankyrin R Monoclonal IgG2B
MBS807348-01mg 0.1mg
EUR 490

Mouse Anti-Human Ankyrin R Monoclonal IgG2B
MBS807348-5x01mg 5x0.1mg
EUR 1935

Mouse Anti-Human Ankyrin R Monoclonal IgG2B
MBS807362-01mg 0.1mg
EUR 475

Mouse Anti-Human Ankyrin R Monoclonal IgG2B
MBS807362-5x01mg 5x0.1mg
EUR 1885

Mouse Anti-Human Ankyrin R Monoclonal IgG2B
MBS806979-01mg 0.1mg
EUR 490

Mouse Anti-Human Ankyrin R Monoclonal IgG2B
MBS806979-5x01mg 5x0.1mg
EUR 1945

Mouse Anti-Human Ankyrin R Monoclonal IgG2B
MBS806985-01mg 0.1mg
EUR 485

Mouse Anti-Human Ankyrin R Monoclonal IgG2B
MBS806985-5x01mg 5x0.1mg
EUR 1920

Mouse Anti-Human Ankyrin R Monoclonal IgG2B
MBS807071-01mg 0.1mg
EUR 490

Mouse Anti-Human Ankyrin R Monoclonal IgG2B
MBS807071-5x01mg 5x0.1mg
EUR 1940

Mouse Anti-Human Ankyrin R Monoclonal IgG2B
MBS807188-01mg 0.1mg
EUR 435

Mouse Anti-Human Ankyrin R Monoclonal IgG2B
MBS807188-5x01mg 5x0.1mg
EUR 1700

Mouse Anti-Human Ankyrin R Monoclonal IgG2B
MBS807190-01mg 0.1mg
EUR 485

Mouse Anti-Human Ankyrin R Monoclonal IgG2B
MBS807190-5x01mg 5x0.1mg
EUR 1925

Mouse Anti-Human Ankyrin R Monoclonal IgG2B
MBS807197-01mg 0.1mg
EUR 490

Mouse Anti-Human Ankyrin R Monoclonal IgG2B
MBS807197-5x01mg 5x0.1mg
EUR 1940

Mouse Anti-Human Ankyrin R Monoclonal IgG2B
MBS807266-01mg 0.1mg
EUR 480

Mouse Anti-Human Ankyrin R Monoclonal IgG2B
MBS807266-5x01mg 5x0.1mg
EUR 1915

Mouse Anti-Rat Nav beta 3 Monoclonal IgG2B
MBS807356-01mg 0.1mg
EUR 485

Mouse Anti-Rat Nav beta 3 Monoclonal IgG2B
MBS807356-5x01mg 5x0.1mg
EUR 1925

Mouse Anti-Rat Nav beta 3 Monoclonal IgG2B
MBS807365-01mg 0.1mg
EUR 490

Mouse Anti-Rat Nav beta 3 Monoclonal IgG2B
MBS807365-5x01mg 5x0.1mg
EUR 1940

Mouse Anti-Rat Nav beta 3 Monoclonal IgG2B
MBS806989-01mg 0.1mg
EUR 485

Mouse Anti-Rat Nav beta 3 Monoclonal IgG2B
MBS806989-5x01mg 5x0.1mg
EUR 1920

Mouse Anti-Rat Nav beta 3 Monoclonal IgG2B
MBS807046-01mg 0.1mg
EUR 480

Mouse Anti-Rat Nav beta 3 Monoclonal IgG2B
MBS807046-5x01mg 5x0.1mg
EUR 1905

Mouse Anti-Rat Nav beta 3 Monoclonal IgG2B
MBS807144-01mg 0.1mg
EUR 490

Mouse Anti-Rat Nav beta 3 Monoclonal IgG2B
MBS807144-5x01mg 5x0.1mg
EUR 1945

Mouse Anti-Rat Nav beta 3 Monoclonal IgG2B
MBS807193-01mg 0.1mg
EUR 435

Mouse Anti-Rat Nav beta 3 Monoclonal IgG2B
MBS807193-5x01mg 5x0.1mg
EUR 1700

Mouse Anti-Rat Nav beta 3 Monoclonal IgG2B
MBS807226-01mg 0.1mg
EUR 490

Mouse Anti-Rat Nav beta 3 Monoclonal IgG2B
MBS807226-5x01mg 5x0.1mg
EUR 1935

Mouse Anti-Rat Nav beta 3 Monoclonal IgG2B
MBS807235-01mg 0.1mg
EUR 480

Mouse Anti-Rat Nav beta 3 Monoclonal IgG2B
MBS807235-5x01mg 5x0.1mg
EUR 1915

Mouse Anti-Rat Nav beta 3 Monoclonal IgG2B
MBS807236-01mg 0.1mg
EUR 475

Mouse Anti-Rat Nav beta 3 Monoclonal IgG2B
MBS807236-5x01mg 5x0.1mg
EUR 1885

Ataxin 1 monoclonal antibody
MB10580 50ul
EUR 398
Description: 50mM Tris-Glycine(pH 7.4), 0.15M NaCl, 40% Glycerol, 0.01% Sodium azide and 0.05% BSA

Anti-Ofloxacin antibody *Mouse anti-human, monoclonal IgG2b*
V100235 50 ug
EUR 367.2

Anti-Ofloxacin antibody *Mouse anti-human, monoclonal IgG2b*
V100236 1 mg
EUR 1306.8

Ataxin-1 Monoclonal Antibody
BT-MCA0188-100ul 100ul Ask for price
Description: The autosomal dominant cerebellar ataxias (ADCA) are a heterogeneous group of neurodegenerative disorders characterized by progressive degeneration of the cerebellum, brain stem and spinal cord. Clinically, ADCA has been divided into three groups: ADCA types I-III. ADCAI is genetically heterogeneous, with five genetic loci, designated spinocerebellar ataxia (SCA) 1, 2, 3, 4 and 6, being assigned to five different chromosomes. ADCAII, which always presents with retinal degeneration (SCA7), and ADCAIII often referred to as the `pure' cerebellar syndrome (SCA5), are most likely homogeneous disorders. Several SCA genes have been cloned and shown to contain CAG repeats in their coding regions. ADCA is caused by the expansion of the CAG repeats, producing an elongated polyglutamine tract in the corresponding protein. The expanded repeats are variable in size and unstable, usually increasing in size when transmitted

Ataxin-1 Monoclonal Antibody
BT-MCA0188-50ul 50ul Ask for price
Description: The autosomal dominant cerebellar ataxias (ADCA) are a heterogeneous group of neurodegenerative disorders characterized by progressive degeneration of the cerebellum, brain stem and spinal cord. Clinically, ADCA has been divided into three groups: ADCA types I-III. ADCAI is genetically heterogeneous, with five genetic loci, designated spinocerebellar ataxia (SCA) 1, 2, 3, 4 and 6, being assigned to five different chromosomes. ADCAII, which always presents with retinal degeneration (SCA7), and ADCAIII often referred to as the `pure' cerebellar syndrome (SCA5), are most likely homogeneous disorders. Several SCA genes have been cloned and shown to contain CAG repeats in their coding regions. ADCA is caused by the expansion of the CAG repeats, producing an elongated polyglutamine tract in the corresponding protein. The expanded repeats are variable in size and unstable, usually increasing in size when transmitted

Ataxin-1 Monoclonal Antibody
JOT-MCA0188-100ul 100ul
EUR 220

Ataxin-1 Monoclonal Antibody
JOT-MCA0188-50ul 50ul
EUR 144

Ataxin-1 Monoclonal Antibody
MBS191333-01mg 0.1mg
EUR 650

Ataxin-1 Monoclonal Antibody
MBS191333-5x01mg 5x0.1mg
EUR 2925

Ataxin-1 Monoclonal Antibody
MBS191334-01mg 0.1mg
EUR 650

Ataxin-1 Monoclonal Antibody
MBS191334-5x01mg 5x0.1mg
EUR 2925

Ataxin-1 Monoclonal Antibody
UB-GEN-3311 100 ul
EUR 200

Anti-Testosterone antibody *Mouse anti-human, monoclonal IgG2b*
V100190 50 ug
EUR 367.2

Anti-Testosterone antibody *Mouse anti-human, monoclonal IgG2b*
V100191 1 mg
EUR 680.4

Anti-Enrofloxacin antibody *Mouse anti-human, monoclonal IgG2b*
V100260 50 ug
EUR 367.2

Anti-Enrofloxacin antibody *Mouse anti-human, monoclonal IgG2b*
V100261 1 mg
EUR 1306.8

Anti-Folic acid antibody *Mouse anti-human, monoclonal IgG2b*
V100200 50 ug
EUR 367.2

Anti-Folic acid antibody *Mouse anti-human, monoclonal IgG2b*
V100201 1 mg
EUR 889.2

Mouse Monoclonal Anti-Rat CD134, PE (Clone OX40) (mouse IgG2b)
RCD134-PE 100 tests
EUR 562.8

Mouse Monoclonal Anti-Rat CD134, FITC (Clone OX40) (mouse IgG2b)
RCD134-F 100 tests
EUR 562.8

Anti-Prolactin (PRL) antibody *Mouse anti-human, monoclonal IgG2b*
V100160 50 ug
EUR 367.2

Anti-Prolactin (PRL) antibody *Mouse anti-human, monoclonal IgG2b*
V100161 1 mg
EUR 471.6

Mouse Anti-HDM IgG2b Monoclonal Antibody, Clone 3C4H2
7112 1 mg/ml x 0.1 ml
EUR 238
Description: Mouse Anti-HDM IgG2b Monoclonal Antibody

Mouse Monoclonal Anti-Mouse CD5 (Ly 1.2), PE (Clone CG16) (mouse IgG2b)
MCD005-PE 100 tests
EUR 562.8

Mouse Anti-SEB IgG2b Monoclonal Antibody, Clone 5D12C9
7105 1 mg/ml x 0.1 ml
EUR 321
Description: Mouse Anti-SEB IgG2b Monoclonal Antibody

Mouse Monoclonal Anti-Rat CD134, Biotin (Clone OX40) (mouse IgG2b)
RCD134-B 100 tests
EUR 562.8

Mouse Anti-SEA IgG2b Monoclonal Antibody, Clone 1E10G12
7108 1 mg/ml x 0.1 ml
EUR 321
Description: Mouse Anti-SEA IgG2b Monoclonal Antibody

Mouse Anti-Ro60 IgG2b Monoclonal Antibody, Clone 2D6E12
7125 1 mg/ml x 0.1 ml
EUR 238
Description: Mouse Anti-Ro60 IgG2b Monoclonal Antibody

Anti-Procalcitonin (PCT) antibody *Mouse anti-human, monoclonal IgG2b*
V100115 50 ug
EUR 367.2

Anti-Procalcitonin (PCT) antibody *Mouse anti-human, monoclonal IgG2b*
V100116 1 mg
EUR 471.6

Mouse Monoclonal Anti-Mouse CD5 (Ly 1.2), FITC (Clone CG16) (mouse IgG2b)
MCD005-F 100 tests
EUR 562.8

Mouse Monoclonal Anti-Rat CD134, Purified (Clone OX40) (mouse IgG2b)
RCD134-M 100 tests
EUR 578.4

Anti-Myeloperoxidase (MPO) antibody *Mouse anti-human, monoclonal IgG2b*
V100095 50 ug
EUR 367.2

Anti-Myeloperoxidase (MPO) antibody *Mouse anti-human, monoclonal IgG2b*
V100096 1 mg
EUR 889.2

Mouse Monoclonal Anti-Mouse CD5 (Ly 1.2), Biotin (Clone CG16) (mouse IgG2b)
MCD005-B 100 tests
EUR 562.8

Mouse Anti-Mouse PD-L1 IgG2b Monoclonal Antibody, Clone 3H9G2
7134 2 mg/ml x 5.0 ml
EUR 524

Mouse Monoclonal [clone AT3A2] (IgG2b,k) to Human MAT2A
MBS245410-005mL 0.05mL
EUR 595

Mouse Monoclonal [clone AT3A2] (IgG2b,k) to Human MAT2A
MBS245410-5x005mL 5x0.05mL
EUR 2500

Anti-Chenodeoxycholic acid antibody *Mouse anti-human, monoclonal IgG2b*
V100225 50 ug
EUR 367.2

Anti-Chenodeoxycholic acid antibody *Mouse anti-human, monoclonal IgG2b*
V100226 1 mg
EUR 889.2

Mouse Anti-Gliadin IgG2b Monoclonal Antibody, Clone 3A10H10
7149 1 mg/ml x 0.1 ml
EUR 238

Mouse Anti-Ovalbumin IgG2b Monoclonal Antibody, Clone 4B4E6
7096 1 mg/ml x 0.1 ml
EUR 238
Description: Mouse Anti-Ovalbumin IgG2b Monoclonal Antibody

Mouse Monoclonal (IgG2b) to Human Trypsin
MBS246107-005mg 0.05mg
EUR 595

Mouse Monoclonal (IgG2b) to Human Trypsin
MBS246107-5x005mg 5x0.05mg
EUR 2500

Mouse Monoclonal Anti-Mouse CD5 (Ly 1.2), No Azide (Clone CG16) (mouse IgG2b)
MCD005-M 100 Tests
EUR 578.4

Anti-C-reactive protein antibody *Mouse anti-human, monoclonal IgG2b*
V100150 50 ug
EUR 367.2

Anti-C-reactive protein antibody *Mouse anti-human, monoclonal IgG2b*
V100151 1 mg
EUR 471.6

Mouse Monoclonal (IgG2b) to Human SERPINE1 / PAI-1
MBS246358-005mL 0.05mL
EUR 595

Mouse Monoclonal (IgG2b) to Human SERPINE1 / PAI-1
MBS246358-5x005mL 5x0.05mL
EUR 2500

Mouse Monoclonal [clone S60-4] (IgG2b)
MBS246001-005mg 0.05mg
EUR 595

Mouse Monoclonal [clone S60-4] (IgG2b)
MBS246001-5x005mg 5x0.05mg
EUR 2500

Ataxin 3 monoclonal antibody
MB11923 50ul
EUR 398
Description: 50mM Tris-Glycine(pH 7.4), 0.15M NaCl, 40% Glycerol, 0.01% Sodium azide and 0.05% BSA

Rat Anti Mouse Igg2b Heavy Chain Monoclonal Antibody,FITC
CABT-54635RM 0.5 mg
EUR 546
Description: Rat

Anti-Alpha-1-microglobulin protein antibody *Mouse anti-human, monoclonal IgG2b*
V100035 50 ug
EUR 367.2

Anti-Alpha-1-microglobulin protein antibody *Mouse anti-human, monoclonal IgG2b*
V100036 1 mg
EUR 367.2

Monoclonal antibody for Ataxin 1
SMC-455D-A565 0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical). . The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with ATTO 565.

Monoclonal antibody for Ataxin 1
SMC-455D-A633 0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical). . The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with ATTO 633.

Monoclonal antibody for Ataxin 1
SMC-455D-A655 0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical). . The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with ATTO 655.

Monoclonal antibody for Ataxin 1
SMC-455D-A680 0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical). . The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with ATTO 680.

Monoclonal antibody for Ataxin 1
SMC-455D-A700 0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical). . The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with ATTO 700.

Monoclonal antibody for Ataxin 1
SMC-455D-APCCY7 0.1mg
EUR 564
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical). . The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with APC/Cy7.

Monoclonal antibody for Ataxin 1
SMC-455D-DY350 0.1mg
EUR 495.6
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical). . The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with Dylight 350.

Monoclonal antibody for Ataxin 1
SMC-455D-DY405 0.1mg
EUR 482.4
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical). . The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with Dylight 405.

Monoclonal antibody for Ataxin 1
SMC-455D-DY488 0.1mg
EUR 470.4
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical). . The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with Dylight 488.

Monoclonal antibody for Ataxin 1
SMC-455D-DY594 0.1mg
EUR 472.8
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical). . The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with Dylight 594.

Monoclonal antibody for Ataxin 1
SMC-455D-DY633 0.1mg
EUR 466.8
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical). . The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with Dylight 633.

Monoclonal antibody for Ataxin 1
SMC-455D-P594 0.1mg
EUR 487.2
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical). . The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with PE/ATTO 594.

Monoclonal antibody for Ataxin 1
SMC-455D-STR 0.1mg
EUR 476.4
Description: A monoclonal antibody from clone S76-8 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical). . The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with Streptavidin.

Monoclonal antibody for Ataxin 1
SMC-475D-A565 0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical). . The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with ATTO 565.

Monoclonal antibody for Ataxin 1
SMC-475D-A633 0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical). . The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with ATTO 633.

Monoclonal antibody for Ataxin 1
SMC-475D-A655 0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical). . The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with ATTO 655.

Monoclonal antibody for Ataxin 1
SMC-475D-A680 0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical). . The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with ATTO 680.

Monoclonal antibody for Ataxin 1
SMC-475D-A700 0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical). . The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with ATTO 700.

Monoclonal antibody for Ataxin 1
SMC-475D-APCCY7 0.1mg
EUR 564
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical). . The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with APC/Cy7.

Monoclonal antibody for Ataxin 1
SMC-475D-DY350 0.1mg
EUR 495.6
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical). . The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with Dylight 350.

Monoclonal antibody for Ataxin 1
SMC-475D-DY405 0.1mg
EUR 482.4
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical). . The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with Dylight 405.

Monoclonal antibody for Ataxin 1
SMC-475D-DY488 0.1mg
EUR 470.4
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical). . The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with Dylight 488.

Monoclonal antibody for Ataxin 1
SMC-475D-DY594 0.1mg
EUR 472.8
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical). . The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with Dylight 594.

Monoclonal antibody for Ataxin 1
SMC-475D-DY633 0.1mg
EUR 466.8
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical). . The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with Dylight 633.

Monoclonal antibody for Ataxin 1
SMC-475D-P594 0.1mg
EUR 487.2
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical). . The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with PE/ATTO 594.

Monoclonal antibody for Ataxin 1
SMC-475D-STR 0.1mg
EUR 476.4
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical). . The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with Streptavidin.

Rat Anti Mouse Igg2b Heavy Chain Monoclonal Antibody,Biotin
CABT-54634RM 0.5 mg
EUR 546
Description: Rat

Mouse Monoclonal (IgG2b) to Human MME / CD10
MBS245033-005mL 0.05mL
EUR 595

Mouse Monoclonal (IgG2b) to Human MME / CD10
MBS245033-5x005mL 5x0.05mL
EUR 2500
Moreover, built-in stress response activation enhances SCA3 RAN translation. Our findings recommend that the ATXN3 sequence context performs an necessary function in triggering SCA3 RAN translation and that SCA3 RAN proteins might trigger mobile toxicity.

Leave a Reply

Your email address will not be published.