The neurodegenerative illness Machado-Joseph illness (MJD), often known as spinocerebellar ataxin-3, impacts neurons of the mind and spinal twine, disrupting management of the motion of muscle groups. Now we have efficiently established the primary transgenic zebrafish (Danio rerio) mannequin of MJD by expressing human ataxin-Three protein containing both 23 glutamines (23Q, wild-type) or 84Q (MJD-causing) inside neurons. Phenotypic characterization of the zebrafish (female and male) revealed that the ataxin-3-84Q zebrafish have decreased survival in contrast with ataxin-3-23Q and develop ataxin-Three neuropathology, ataxin-Three cleavage fragments and motor impairment. Ataxin-3-84Q zebrafish swim shorter distances than ataxin-3-23Q zebrafish as early as 6 days previous, even when expression of the human ataxin-Three protein is proscribed to motor neurons.
This swimming phenotype gives a invaluable readout for drug therapy research. Treating the EGFP-ataxin-3-84Q zebrafish with the calpain inhibitor compound calpeptin decreased ranges of ataxin-Three cleavage fragments, but in addition eliminated all human ataxin-Three protein (confirmed by ELISA) and prevented the early MJD zebrafish motor phenotype. We recognized that this clearance of ataxin-Three protein by calpeptin therapy resulted from a rise in autophagic flux (indicated by decreased p62 ranges and elevated LC3II). Cotreatment with the autophagy inhibitor chloroquine blocked the lower in human ataxin-Three ranges and the improved motion produced by calpeptin therapy. This examine demonstrates that this primary transgenic zebrafish mannequin of MJD is a invaluable instrument for testing potential therapies for MJD. Calpeptin therapy is protecting on this mannequin of MJD and removing of human ataxin-Three by means of macro-autophagy performs an essential function on this useful impact.
SIGNIFICANCE STATEMENT Now we have established the primary transgenic zebrafish mannequin of the neurodegenerative illness MJD, and recognized related illness phenotypes, together with impaired motion from an early age, which can be utilized in fast drug testing research. Now we have discovered that treating the MJD zebrafish with the calpain inhibitor compound calpeptin produces full removing of human ataxin-Three protein, as a consequence of induction of the autophagy high quality management pathway. This improves the motion of the MJD zebrafish. Artificially blocking the autophagy pathway prevents the removing of human ataxin-Three and improved motion produced by calpeptin therapy. These findings point out that induction of autophagy, and removing of ataxin-Three protein, performs an essential function within the protecting results of calpain inhibition for the therapy of MJD.
Disruption of the ATXN1-CIC complicated causes a spectrum of neurobehavioral phenotypes in mice and people.

Calpain Inhibition Is Protective in Machado-Joseph Disease Zebrafish Due to Induction of Autophagy.
Epigallocatechin-3-gallate and associated phenol compounds redirect the amyloidogenic aggregation pathway of ataxin-Three in the direction of non-toxic aggregates and stop toxicity in neural cells and Caenorhabditis elegans animal mannequin.
Ataxin 7 (ATXN7) Antibody |
|||
abx038315-100ug | Abbexa | 100 ug | EUR 469.2 |
Ataxin 7 (ATXN7) Antibody |
|||
20-abx338870 | Abbexa |
|
|
Ataxin 7 (ATXN7) Antibody (HRP) |
|||
20-abx334734 | Abbexa |
|
|
Ataxin 7 (ATXN7) Antibody (FITC) |
|||
20-abx334735 | Abbexa |
|
|
Ataxin 7 (ATXN7) Antibody (Biotin) |
|||
20-abx334736 | Abbexa |
|
|
Ataxin 7 Like 1 (ATXN7L1) Antibody |
|||
20-abx325156 | Abbexa |
|
|
Ataxin 3 antibody |
|||
22437-100ul | SAB | 100ul | EUR 468 |
Ataxin 1 Antibody |
|||
AF6347 | Affbiotech | 200ul | EUR 420 |
Ataxin 3 antibody |
|||
70R-13630 | Fitzgerald | 100 ul | EUR 548.4 |
Description: Affinity purified Rabbit polyclonal Ataxin 3 antibody |
Ataxin 10 antibody |
|||
70R-50914 | Fitzgerald | 100 ul | EUR 292.8 |
Description: Purified Polyclonal Ataxin 10 antibody |
Ataxin 2 antibody |
|||
70R-50365 | Fitzgerald | 100 ul | EUR 292.8 |
Description: Purified Polyclonal Ataxin 2 antibody |
Ataxin 1 Antibody |
|||
ABF6347 | Lifescience Market | 100 ug | EUR 525.6 |
Ataxin 3 Antibody |
|||
DF6375 | Affbiotech | 200ul | EUR 420 |
Ataxin-7-Like Protein 2 (ATXN7L2) Antibody |
|||
abx219541-100ug | Abbexa | 100 ug | EUR 526.8 |
Ataxin-7-Like Protein 1 (ATXN7L1) Antibody |
|||
20-abx121291 | Abbexa |
|
|
Ataxin-7-Like Protein 2 (ATXN7L2) Antibody |
|||
20-abx121022 | Abbexa |
|
|
Ataxin-7-Like Protein 3 (ATXN7L3) Antibody |
|||
20-abx121023 | Abbexa |
|
|
Ataxin-7-Like Protein 1 (ATXN7L1) Antibody |
|||
20-abx148460 | Abbexa |
|
|
Ataxin-7-Like Protein 3 (ATXN7L3) Antibody |
|||
abx037189-100ug | Abbexa | 100 ug | EUR 469.2 |
Ataxin-7-Like Protein 3 (ATXN7L3) Antibody |
|||
20-abx301379 | Abbexa |
|
|
Ataxin-7-Like Protein 1 (ATXN7L1) Antibody |
|||
20-abx301749 | Abbexa |
|
|
Ataxin-2 Antibody |
|||
R31210 | NSJ Bioreagents | 100 ug | EUR 356.15 |
Description: Ataxin-2, the protein encoded by the ATXN2 gene, contains a polyglutamine tract, long expansions (greater than 33 repeats) of which result in spinocerebellar ataxia-2 (SCA2), an autosomal dominant form of olivopontocerebellar atrophy. The gene for spinocerebellar ataxia type 2(SCA2) has been mapped to 12q24.1. Ataxin-2 associates with L- and T-plastin and overexpression leads to accumulation of T-plastin in mammalian cells. |
Ataxin 7 Like 1 (ATXN7L1) Antibody (HRP) |
|||
20-abx312252 | Abbexa |
|
|
Ataxin 7 Like 3 (ATXN7L3) Antibody (HRP) |
|||
20-abx306773 | Abbexa |
|
|
Ataxin 7 Like 1 (ATXN7L1) Antibody (FITC) |
|||
20-abx312253 | Abbexa |
|
|
Ataxin 7 Like 3 (ATXN7L3) Antibody (FITC) |
|||
20-abx306774 | Abbexa |
|
|
Ataxin 7 Like 1 (ATXN7L1) Antibody (Biotin) |
|||
20-abx312254 | Abbexa |
|
|
Ataxin 7 Like 3 (ATXN7L3) Antibody (Biotin) |
|||
20-abx306775 | Abbexa |
|
|
anti- Ataxin 2 antibody |
|||
FNab00657 | FN Test | 100µg | EUR 606.3 |
Description: Antibody raised against Ataxin 2 |
Ataxin 3 Antibody / ATXN3 |
|||
F55027-0.08ML | NSJ Bioreagents | 0.08 ml | EUR 140.25 |
Description: ATXN3 was known as spinocerebellar ataxia-3, is an autosomal dominant neurologic disorder. The protein contains (CAG)n repeats in the coding region, and the expansion of these repeats from the normal 13-36 to 68-79 is one cause of Machado-Joseph disease. There is a negative correlation between the age of onset and CAG repeat numbers. |
Ataxin 3 Antibody / ATXN3 |
|||
F55027-0.4ML | NSJ Bioreagents | 0.4 ml | EUR 322.15 |
Description: ATXN3 was known as spinocerebellar ataxia-3, is an autosomal dominant neurologic disorder. The protein contains (CAG)n repeats in the coding region, and the expansion of these repeats from the normal 13-36 to 68-79 is one cause of Machado-Joseph disease. There is a negative correlation between the age of onset and CAG repeat numbers. |
Ataxin 3 Antibody / ATXN3 |
|||
R32137 | NSJ Bioreagents | 100 ug | EUR 356.15 |
Description: ATXN3 (Ataxin 3), also known as AT3, MJD GENE, MJD1, SCA3 GENE, ATX3, JOS, Spinocerebellar ataxia-3, Machado-Joseph disease protein 1, is a protein that in humans is encoded by the ATXN3 gene. ATXN3 ranges in size from 360 to 374 amino acids. Using Northern blot analysis showed that ATXN3 mRNA was ubiquitously expressed in human tissues. They detected at least 4 ATXN3 transcripts of 1.4, 1.8, 4.5, and 7.5 kb and suggested that the different mRNA species probably result from differential splicing and polyadenylation. Machado-Joseph disease, also known as spinocerebellar ataxia-3, is an autosomal dominant neurologic disorder. The protein encoded by the ATXN3 gene contains (CAG)n repeats in the coding region, and the expansion of these repeats from the normal 13-36 to 68-79 is the cause of Machado-Joseph disease. There is an inverse correlation between the age of onset and CAG repeat numbers. Alternatively spliced transcript variants encoding different isoforms have been described for this gene. Ataxin-3 interacted with 2 human homologs of the yeast DNA repair protein RAD23, HHR23A (RAD23A) and HHR23B (RAD23B). Both normal and mutant ataxin-3 proteins interacted with the ubiquitin-like domain at the N terminus of the HHR23 proteins, which is a motif important for nucleotide excision repair. However, in HEK 293 cells, HHR23A was recruited to intranuclear inclusions formed by the mutant ataxin-3 through its interaction with ataxin-3. |
Ataxin 1 Antibody / ATXN1 |
|||
R32138 | NSJ Bioreagents | 100 ug | EUR 356.15 |
Description: Ataxin-1 is a protein that in humans is encoded by the ATXN1 gene. The ATXN1 gene had been mapped to 6p23 by in situ hybridization. Ataxin-1 (ATXN1), a causative factor for spinocerebellar ataxia type 1 (SCA1), and the related Brother of ATXN1 (BOAT1) are human proteins involved in transcriptional repression. ATXN1 and BOAT1 might participate in several Notch-controlled developmental and pathological processes. |
Ataxin-2 Antibody / ATXN2 |
|||
R32313 | NSJ Bioreagents | 100 ug | EUR 356.15 |
Description: Ataxin-2, or ATX2, protein is encoded by the ATXN2 gene and contains a polyglutamine tract, long expansions (greater than 33 repeats) of which result in spinocerebellar ataxia-2 (SCA2), an autosomal dominant form of olivopontocerebellar atrophy. The gene for spinocerebellar ataxia type 2 (SCA2) has been mapped to 12q24.1. Ataxin-2 associates with L- and T-plastin and that overexpression of ataxin-2 leads to accumulation of T-plastin in mammalian cells. |
Polyclonal Ataxin 10 Antibody |
|||
APG03169G | Leading Biology | 0.1ml | EUR 580.8 |
Description: A polyclonal antibody raised in Rabbit that recognizes and binds to Human Ataxin 10 . This antibody is tested and proven to work in the following applications: |
Polyclonal Ataxin 2 Antibody |
|||
APG03170G | Leading Biology | 0.1ml | EUR 580.8 |
Description: A polyclonal antibody raised in Rabbit that recognizes and binds to Human Ataxin 2 . This antibody is tested and proven to work in the following applications: |
Ataxin-3 (pS256) Antibody |
|||
abx148457-100ug | Abbexa | 100 ug | EUR 526.8 |
Ataxin-1 Polyclonal Antibody |
|||
40621-100ul | SAB | 100ul | EUR 302.4 |
Ataxin-1 Polyclonal Antibody |
|||
40621-50ul | SAB | 50ul | EUR 224.4 |
Ataxin-2 Polyclonal Antibody |
|||
40622-100ul | SAB | 100ul | EUR 302.4 |
Ataxin-2 Polyclonal Antibody |
|||
40622-50ul | SAB | 50ul | EUR 224.4 |
Ataxin-1 Polyclonal Antibody |
|||
ABP50719-003ml | Abbkine | 0.03ml | EUR 189.6 |
Description: A polyclonal antibody for detection of Ataxin-1 from Human, Mouse. This Ataxin-1 antibody is for WB , IHC-P, IF, ELISA. It is affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogenand is unconjugated. The antibody is produced in rabbit by using as an immunogen synthesized peptide derived from human Ataxin-1 around the non-phosphorylation site of S776 |
Ataxin-1 Polyclonal Antibody |
|||
ABP50719-01ml | Abbkine | 0.1ml | EUR 346.8 |
Description: A polyclonal antibody for detection of Ataxin-1 from Human, Mouse. This Ataxin-1 antibody is for WB , IHC-P, IF, ELISA. It is affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogenand is unconjugated. The antibody is produced in rabbit by using as an immunogen synthesized peptide derived from human Ataxin-1 around the non-phosphorylation site of S776 |
Ataxin-1 Polyclonal Antibody |
|||
ABP50719-02ml | Abbkine | 0.2ml | EUR 496.8 |
Description: A polyclonal antibody for detection of Ataxin-1 from Human, Mouse. This Ataxin-1 antibody is for WB , IHC-P, IF, ELISA. It is affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogenand is unconjugated. The antibody is produced in rabbit by using as an immunogen synthesized peptide derived from human Ataxin-1 around the non-phosphorylation site of S776 |
Ataxin-2 Polyclonal Antibody |
|||
ABP50720-003ml | Abbkine | 0.03ml | EUR 189.6 |
Description: A polyclonal antibody for detection of Ataxin-2 from Human. This Ataxin-2 antibody is for WB , IHC-P, ELISA. It is affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogenand is unconjugated. The antibody is produced in rabbit by using as an immunogen synthesized peptide derived from the Internal region of human Ataxin-2 at AA range: 700-780 |
Ataxin-2 Polyclonal Antibody |
|||
ABP50720-01ml | Abbkine | 0.1ml | EUR 346.8 |
Description: A polyclonal antibody for detection of Ataxin-2 from Human. This Ataxin-2 antibody is for WB , IHC-P, ELISA. It is affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogenand is unconjugated. The antibody is produced in rabbit by using as an immunogen synthesized peptide derived from the Internal region of human Ataxin-2 at AA range: 700-780 |
Ataxin-2 Polyclonal Antibody |
|||
ABP50720-02ml | Abbkine | 0.2ml | EUR 496.8 |
Description: A polyclonal antibody for detection of Ataxin-2 from Human. This Ataxin-2 antibody is for WB , IHC-P, ELISA. It is affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogenand is unconjugated. The antibody is produced in rabbit by using as an immunogen synthesized peptide derived from the Internal region of human Ataxin-2 at AA range: 700-780 |
Ataxin-1 Polyclonal Antibody |
|||
ES1718-100ul | ELK Biotech | 100ul | EUR 334.8 |
Description: A Rabbit Polyclonal antibody against Ataxin-1 from Human/Mouse. This antibody is tested and validated for WB, ELISA, IHC, IF, WB, ELISA |
Ataxin-1 Polyclonal Antibody |
|||
ES1718-50ul | ELK Biotech | 50ul | EUR 248.4 |
Description: A Rabbit Polyclonal antibody against Ataxin-1 from Human/Mouse. This antibody is tested and validated for WB, ELISA, IHC, IF, WB, ELISA |
Ataxin-2 Polyclonal Antibody |
|||
ES1719-100ul | ELK Biotech | 100ul | EUR 334.8 |
Description: A Rabbit Polyclonal antibody against Ataxin-2 from Human. This antibody is tested and validated for WB, ELISA, IHC, WB, ELISA |
Ataxin-2 Polyclonal Antibody |
|||
ES1719-50ul | ELK Biotech | 50ul | EUR 248.4 |
Description: A Rabbit Polyclonal antibody against Ataxin-2 from Human. This antibody is tested and validated for WB, ELISA, IHC, WB, ELISA |
Ataxin-2L Polyclonal Antibody |
|||
40623-100ul | SAB | 100ul | EUR 302.4 |
Ataxin-2L Polyclonal Antibody |
|||
40623-50ul | SAB | 50ul | EUR 224.4 |
Ataxin-2L Polyclonal Antibody |
|||
ABP53629-003ml | Abbkine | 0.03ml | EUR 189.6 |
Description: A polyclonal antibody for detection of Ataxin-2L from Human. This Ataxin-2L antibody is for WB, ELISA. It is affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogenand is unconjugated. The antibody is produced in rabbit by using as an immunogen synthesized peptide derived from the Internal region of human Ataxin-2L at AA rangle: 540-620 |
Ataxin-2L Polyclonal Antibody |
|||
ABP53629-01ml | Abbkine | 0.1ml | EUR 346.8 |
Description: A polyclonal antibody for detection of Ataxin-2L from Human. This Ataxin-2L antibody is for WB, ELISA. It is affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogenand is unconjugated. The antibody is produced in rabbit by using as an immunogen synthesized peptide derived from the Internal region of human Ataxin-2L at AA rangle: 540-620 |
Ataxin-2L Polyclonal Antibody |
|||
ABP53629-02ml | Abbkine | 0.2ml | EUR 496.8 |
Description: A polyclonal antibody for detection of Ataxin-2L from Human. This Ataxin-2L antibody is for WB, ELISA. It is affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogenand is unconjugated. The antibody is produced in rabbit by using as an immunogen synthesized peptide derived from the Internal region of human Ataxin-2L at AA rangle: 540-620 |
Ataxin-2L Polyclonal Antibody |
|||
ES4628-100ul | ELK Biotech | 100ul | EUR 334.8 |
Description: A Rabbit Polyclonal antibody against Ataxin-2L from Human. This antibody is tested and validated for WB, ELISA, WB, ELISA |
Ataxin-2L Polyclonal Antibody |
|||
ES4628-50ul | ELK Biotech | 50ul | EUR 248.4 |
Description: A Rabbit Polyclonal antibody against Ataxin-2L from Human. This antibody is tested and validated for WB, ELISA, WB, ELISA |
Ataxin 2 (ATXN2) Antibody |
|||
abx230657-100ug | Abbexa | 100 ug | EUR 577.2 |
Ataxin 1 (ATXN1) Antibody |
|||
20-abx242069 | Abbexa |
|
|
Ataxin 1 (ATXN1) Antibody |
|||
20-abx100304 | Abbexa |
|
|
Ataxin 1 (ATXN1) Antibody |
|||
20-abx171342 | Abbexa |
|
|
Ataxin 1 (ATXN1) Antibody |
|||
20-abx214569 | Abbexa |
|
|
Ataxin 1 (ATXN1) Antibody |
|||
20-abx133167 | Abbexa |
|
|
Ataxin 1 (pS775) Antibody |
|||
20-abx121842 | Abbexa |
|
|
Ataxin 2 (ATXN2) Antibody |
|||
20-abx324514 | Abbexa |
|
|
Ataxin 1 (ATXN1) Antibody |
|||
20-abx325351 | Abbexa |
|
|
Ataxin 1 (ATXN1) Antibody |
|||
abx445066-100ug | Abbexa | 100 ug | EUR 627.6 |
Ataxin 1 (ATXN1) Antibody |
|||
abx445084-100ug | Abbexa | 100 ug | EUR 627.6 |
Ataxin 2 (ATXN2) Antibody |
|||
20-abx111105 | Abbexa |
|
|
Ataxin 1 (ATXN1) Antibody |
|||
abx031721-400ul | Abbexa | 400 ul | EUR 627.6 |
Ataxin 1 (ATXN1) Antibody |
|||
abx031721-80l | Abbexa | 80 µl | EUR 343.2 |
Ataxin 2 (ATXN2) Antibody |
|||
abx038116-100ug | Abbexa | 100 ug | EUR 469.2 |
Ataxin 1 (ATXN1) Antibody |
|||
20-abx126836 | Abbexa |
|
|
Ataxin 1 (ATXN1) Antibody |
|||
20-abx129635 | Abbexa |
|
|
Ataxin 2 (ATXN2) Antibody |
|||
20-abx124201 | Abbexa |
|
|
Ataxin 1 (ATXN1) Antibody |
|||
20-abx320078 | Abbexa |
|
|
Ataxin 1 (ATXN1) Antibody |
|||
abx431572-200ul | Abbexa | 200 ul | EUR 343.2 |
Ataxin 2 (ATXN2) Antibody |
|||
abx431573-200ul | Abbexa | 200 ul | EUR 343.2 |
Ataxin 1 (ATXN1) Antibody |
|||
abx432383-200ul | Abbexa | 200 ul | EUR 343.2 |
Ataxin 2 (ATXN2) Antibody |
|||
20-abx008736 | Abbexa |
|
|
Ataxin 1 (ATXN1) Antibody |
|||
20-abx004749 | Abbexa |
|
|
Ataxin 1 (pS776) Antibody |
|||
abx010423-100ug | Abbexa | 100 ug | EUR 526.8 |
Ataxin 1 (ATXN1) Antibody |
|||
abx010425-100ul | Abbexa | 100 ul | EUR 493.2 |
Ataxin 1 (ATXN1) Antibody |
|||
abx145346-100ug | Abbexa | 100 ug | EUR 469.2 |
Ataxin 2 (ATXN2) Antibody |
|||
20-abx302483 | Abbexa |
|
|
Ataxin-7L1 Polyclonal Antibody |
|||
ABP54236-003ml | Abbkine | 0.03ml | EUR 189.6 |
Description: A polyclonal antibody for detection of Ataxin-7L1 from Human, Mouse. This Ataxin-7L1 antibody is for IHC-P, ELISA. It is affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogenand is unconjugated. The antibody is produced in rabbit by using as an immunogen synthesized peptide derived from the Internal region of human Ataxin-7L1 at AA rangle: 410-490 |
Ataxin-7L1 Polyclonal Antibody |
|||
ABP54236-01ml | Abbkine | 0.1ml | EUR 346.8 |
Description: A polyclonal antibody for detection of Ataxin-7L1 from Human, Mouse. This Ataxin-7L1 antibody is for IHC-P, ELISA. It is affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogenand is unconjugated. The antibody is produced in rabbit by using as an immunogen synthesized peptide derived from the Internal region of human Ataxin-7L1 at AA rangle: 410-490 |
Ataxin-7L1 Polyclonal Antibody |
|||
ABP54236-02ml | Abbkine | 0.2ml | EUR 496.8 |
Description: A polyclonal antibody for detection of Ataxin-7L1 from Human, Mouse. This Ataxin-7L1 antibody is for IHC-P, ELISA. It is affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogenand is unconjugated. The antibody is produced in rabbit by using as an immunogen synthesized peptide derived from the Internal region of human Ataxin-7L1 at AA rangle: 410-490 |
Ataxin-7L1 Polyclonal Antibody |
|||
ES5235-100ul | ELK Biotech | 100ul | EUR 334.8 |
Description: A Rabbit Polyclonal antibody against Ataxin-7L1 from Human/Mouse. This antibody is tested and validated for IHC, WB, ELISA |
Ataxin-7L1 Polyclonal Antibody |
|||
ES5235-50ul | ELK Biotech | 50ul | EUR 248.4 |
Description: A Rabbit Polyclonal antibody against Ataxin-7L1 from Human/Mouse. This antibody is tested and validated for IHC, WB, ELISA |
Ataxin 10 (ATXN10) Antibody |
|||
abx230740-100ug | Abbexa | 100 ug | EUR 577.2 |
Ataxin 10 (ATXN10) Antibody |
|||
20-abx175488 | Abbexa |
|
|
Ataxin 10 (ATXN10) Antibody |
|||
20-abx175489 | Abbexa |
|
|
Ataxin 10 (ATXN10) Antibody |
|||
20-abx171343 | Abbexa |
|
|
Ataxin 10 (ATXN10) Antibody |
|||
20-abx148456 | Abbexa |
|
|
Ataxin 10 (ATXN10) Antibody |
|||
20-abx322080 | Abbexa |
|
|
Ataxin 10 (ATXN10) Antibody |
|||
20-abx111104 | Abbexa |
|
|
Ataxin 10 (ATXN10) Antibody |
|||
abx037722-100ug | Abbexa | 100 ug | EUR 469.2 |
Ataxin 10 (ATXN10) Antibody |
|||
20-abx128172 | Abbexa |
|
|
Ataxin 10 (ATXN10) Antibody |
|||
20-abx003447 | Abbexa |
|
|
Ataxin 10 (ATXN10) Antibody |
|||
20-abx008222 | Abbexa |
|
|
SCA2 Antibody / ATXN2 / Ataxin-2 |
|||
RQ6945 | NSJ Bioreagents | 100 ug | EUR 356.15 |
Description: Ataxin-2, the protein encoded by the ATXN2 gene, contains a polyglutamine tract, long expansions (greater than 33 repeats) of which result in spinocerebellar ataxia-2 (SCA2), an autosomal dominant form of olivopontocerebellar atrophy. The gene for spinocerebellar ataxia type 2 (SCA2) has been mapped to 12q24.1. Ataxin-2 associates with L- and T-plastin and that overexpression of ataxin-2 leads to accumulation of T-plastin in mammalian cells. |
Ataxin 7 Blocking Peptide |
|||
20-abx161290 | Abbexa |
|
|
Ataxin 3 Polyclonal Antibody |
|||
27857-100ul | SAB | 100ul | EUR 302.4 |
Ataxin 3 Polyclonal Antibody |
|||
27857-50ul | SAB | 50ul | EUR 224.4 |
Ataxin 3 Polyclonal Antibody |
|||
A70452 | EpiGentek |
|
|
Ataxin 2 (ATXN2) Antibody (HRP) |
|||
20-abx314635 | Abbexa |
|
|
Ataxin 1 (ATXN1) Antibody (RPE) |
|||
abx444428-100ug | Abbexa | 100 ug | EUR 693.6 |
Ataxin 1 (ATXN1) Antibody (RPE) |
|||
abx444446-100ug | Abbexa | 100 ug | EUR 693.6 |
Ataxin 1 (ATXN1) Antibody (HRP) |
|||
abx443585-100ug | Abbexa | 100 ug | EUR 678 |
Ataxin 1 (ATXN1) Antibody (HRP) |
|||
abx443603-100ug | Abbexa | 100 ug | EUR 678 |
Ataxin 1 (ATXN1) Antibody (ALP) |
|||
abx442463-100ug | Abbexa | 100 ug | EUR 693.6 |
Ataxin 1 (ATXN1) Antibody (ALP) |
|||
abx442481-100ug | Abbexa | 100 ug | EUR 693.6 |
Ataxin 1 (ATXN1) Antibody (APC) |
|||
abx442744-100ug | Abbexa | 100 ug | EUR 693.6 |
Ataxin 1 (ATXN1) Antibody (APC) |
|||
abx442762-100ug | Abbexa | 100 ug | EUR 693.6 |
Ataxin-3 (Phospho-Ser256) Antibody |
|||
12574-100ul | SAB | 100ul | EUR 302.4 |
Ataxin-3 (Phospho-Ser256) Antibody |
|||
12574-50ul | SAB | 50ul | EUR 224.4 |
Ataxin 2 (ATXN2) Antibody (FITC) |
|||
20-abx314636 | Abbexa |
|
|
Ataxin 3 / ATX3 (ATXN3) Antibody |
|||
20-abx318334 | Abbexa |
|
|
Ataxin 3 / ATX3 (ATXN3) Antibody |
|||
20-abx225054 | Abbexa |
|
|
Ataxin 3 / ATX3 (ATXN3) Antibody |
|||
20-abx111106 | Abbexa |
|
|
Ataxin 3 / ATX3 (ATXN3) Antibody |
|||
abx036768-100ug | Abbexa | 100 ug | EUR 469.2 |
Ataxin 3 / ATX3 (ATXN3) Antibody |
|||
abx038360-100ug | Abbexa | 100 ug | EUR 469.2 |
Ataxin 1 (ATXN1) Antibody (FITC) |
|||
abx443304-100ug | Abbexa | 100 ug | EUR 678 |
Ataxin 1 (ATXN1) Antibody (FITC) |
|||
abx443322-100ug | Abbexa | 100 ug | EUR 678 |
Ataxin 3 / ATX3 (ATXN3) Antibody |
|||
20-abx001155 | Abbexa |
|
|
Ataxin 1 Like (ATXN1L) Antibody |
|||
abx030547-400ul | Abbexa | 400 ul | EUR 627.6 |
Ataxin 1 Like (ATXN1L) Antibody |
|||
abx030547-80l | Abbexa | 80 µl | EUR 343.2 |
Ataxin 2 Like (ATXN2L) Antibody |
|||
20-abx323617 | Abbexa |
|
|
Ataxin 1 (ATXN1) Antibody (PerCP) |
|||
abx444147-100ug | Abbexa | 100 ug | EUR 693.6 |
Ataxin 1 (ATXN1) Antibody (PerCP) |
|||
abx444165-100ug | Abbexa | 100 ug | EUR 693.6 |
Ataxin 1 Like (ATXN1L) Antibody |
|||
20-abx301794 | Abbexa |
|
|
Ataxin 2 (ATXN2) Antibody (Biotin) |
|||
20-abx314637 | Abbexa |
|
|
Ataxin 1 (ATXN1) Antibody (Biotin) |
|||
abx443024-100ug | Abbexa | 100 ug | EUR 693.6 |
Ataxin 1 (ATXN1) Antibody (Biotin) |
|||
abx443042-100ug | Abbexa | 100 ug | EUR 693.6 |
Ataxin-1 Polyclonal Conjugated Antibody |
|||
C40621 | SAB | 100ul | EUR 476.4 |
Ataxin-2 Polyclonal Conjugated Antibody |
|||
C40622 | SAB | 100ul | EUR 476.4 |
Phospho- Ataxin 1 (Ser775) Antibody |
|||
ABF3347 | Lifescience Market | 100 ug | EUR 525.6 |
Ataxin- 3 (Phospho- Ser256) Antibody |
|||
ABF8242 | Lifescience Market | 100 ug | EUR 525.6 |
Monoclonal antibody for Ataxin 1 |
|||
SMC-455D | Stressmarq | 0.1mg | EUR 423.6 |
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical).
. The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is not conjugated. |
Monoclonal antibody for Ataxin 1 |
|||
SMC-455D-A390 | Stressmarq | 0.1mg | EUR 480 |
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical).
. The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with ATTO 390. |
Monoclonal antibody for Ataxin 1 |
|||
SMC-455D-A488 | Stressmarq | 0.1mg | EUR 478.8 |
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical).
. The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with ATTO 488. |
Monoclonal antibody for Ataxin 1 |
|||
SMC-455D-A565 | Stressmarq | 0.1mg | EUR 478.8 |
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical).
. The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with ATTO 565. |
Monoclonal antibody for Ataxin 1 |
|||
SMC-455D-A594 | Stressmarq | 0.1mg | EUR 478.8 |
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical).
. The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with ATTO 594. |
Monoclonal antibody for Ataxin 1 |
|||
SMC-455D-A633 | Stressmarq | 0.1mg | EUR 478.8 |
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical).
. The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with ATTO 633. |
Monoclonal antibody for Ataxin 1 |
|||
SMC-455D-A655 | Stressmarq | 0.1mg | EUR 478.8 |
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical).
. The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with ATTO 655. |
Monoclonal antibody for Ataxin 1 |
|||
SMC-455D-A680 | Stressmarq | 0.1mg | EUR 478.8 |
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical).
. The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with ATTO 680. |
Monoclonal antibody for Ataxin 1 |
|||
SMC-455D-A700 | Stressmarq | 0.1mg | EUR 478.8 |
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical).
. The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with ATTO 700. |
Monoclonal antibody for Ataxin 1 |
|||
SMC-455D-ALP | Stressmarq | 0.1mg | EUR 471.6 |
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical).
. The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with Alkaline Phosphatase. |
Monoclonal antibody for Ataxin 1 |
|||
SMC-455D-APC | Stressmarq | 0.1mg | EUR 477.6 |
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical).
. The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with APC. |
Monoclonal antibody for Ataxin 1 |
|||
SMC-455D-APCCY7 | Stressmarq | 0.1mg | EUR 564 |
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical).
. The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with APC/Cy7. |
Monoclonal antibody for Ataxin 1 |
|||
SMC-455D-BI | Stressmarq | 0.1mg | EUR 474 |
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical).
. The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with Biotin. |
Monoclonal antibody for Ataxin 1 |
|||
SMC-455D-DY350 | Stressmarq | 0.1mg | EUR 495.6 |
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical).
. The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with Dylight 350. |
Monoclonal antibody for Ataxin 1 |
|||
SMC-455D-DY405 | Stressmarq | 0.1mg | EUR 482.4 |
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical).
. The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with Dylight 405. |
Monoclonal antibody for Ataxin 1 |
|||
SMC-455D-DY488 | Stressmarq | 0.1mg | EUR 470.4 |
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical).
. The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with Dylight 488. |