Background: Aberrations in Capicua (CIC) have lately been implicated as a adverse prognostic consider a mess of most cancers sorts by means of the derepression of targets downstream of the mitogen-activated protein kinase (MAPK) signaling cascade, similar to oncogenic E26 transformation-specific (ETS) transcription components. The Ataxin-family protein ATXN1L has beforehand been reported to work together with CIC in each developmental and illness contexts to facilitate the repression of CIC goal genes and promote the post-translational stability of CIC. Nevertheless, little is understood concerning the mechanisms on the base of ATXN1L-mediated CIC post-translational stability.
Outcomes: Useful in vitro research using ATXN1L human cell traces revealed that lack of ATXN1L results in the buildup of polyubiquitinated CIC protein, selling its degradation by means of the proteasome. Though transcriptomic signatures of ATXN1LKO cell traces indicated upregulation of the mitogen-activated protein kinase pathway, ERK exercise was discovered to contribute to CIC operate however not stability. Degradation of CIC protein following lack of ATXN1L was as an alternative noticed to be mediated by the E3 ubiquitin ligase TRIM25 which was additional validated utilizing glioma-derived cell traces and the TCGA breast carcinoma and liver hepatocellular carcinoma cohorts.
Conclusions: The post-translational regulation of CIC by means of ATXN1L and TRIM25 unbiased of ERK exercise means that the regulation of CIC stability and performance is extra intricate than beforehand appreciated and includes a number of unbiased pathways. As CIC standing has develop into a prognostic consider a number of most cancers sorts, additional data into the mechanisms which govern CIC stability and performance could show helpful for future therapeutic approaches.
Ataxin-2 Dysregulation Triggers a Compensatory Fragile X Psychological Retardation Protein Lower in Drosophila C4da Neurons
Dendrites require exact and well timed supply of protein substrates to distal areas to make sure the proper morphology and performance of neurons. Many of those protein substrates are equipped within the type of ribonucleoprotein (RNP) complicated consisting of RNA-binding proteins (RBPs) and mRNAs, that are subsequently translated in distal dendritic areas. It stays elusive, nonetheless, whether or not key RBPs provide mRNA in line with native calls for individually or in a coordinated method.
On this examine, we investigated how Drosophila sensory neurons reply to the dysregulation of a disease-associated RBP, Ataxin-2 (ATX2), which ends up in dendritic defects. We discovered that ATX2 performs an important function in spacing dendritic branches for the optimum dendritic receptive fields in Drosophila class IV dendritic arborization (C4da) neurons, the place each expression degree and subcellular location of ATX2 contribute considerably to this impact. We confirmed that translational upregulation by means of the expression of eukaryotic translation initiation issue 4E (eIF4E) additional enhanced the ATX2-induced dendritic phenotypes. Moreover, we discovered that the expression degree of one other disease-associated RBP, fragile X psychological retardation protein (FMRP), decreased in each cell our bodies and dendrites when neurons had been confronted with aberrant upregulation of ATX2. Lastly, we revealed that the PAM2 motif of ATX2, which mediates its interplay with poly(A)-binding protein (PABP), is probably mandatory for the lower of FMRP in sure neuronal stress situations.
Collectively, our knowledge counsel that dysregulation of RBPs triggers a compensatory regulation of different functionally-overlapping RBPs to reduce RBP dysregulation-associated aberrations that hinder neuronal homeostasis in dendrites. Lignin-carbohydrate complicated (LCC) is the organic macromolecule that has been demonstrated to exert a number of organic capabilities, together with antioxidant, anti-inflammation and anti-tumorigenesis, which help its broad utility within the bioengineering discipline. Nevertheless, it stays elusive the involvements of LCC in human neurological issues, particularly these with the overproduction of reactive oxygen species (ROS), similar to spinocerebellar ataxias (SCAs). On this examine, we discovered a beforehand undetermined anti-protein aggregation exercise of LCC.
Intracellular dynamics of Ataxin-2 within the human brains with regular and frontotemporal lobar degeneration with TDP-43 inclusions
TAR DNA-binding protein of 43 kDa (TDP-43) is a serious element of intracellular aggregates fashioned in brains of the sufferers with frontotemporal lobar degeneration (FTLD) and amyotrophic lateral sclerosis (ALS), that are correctively known as TDP-43 proteinopathies. A hyperlink between Ataxin-2 (ATXN2) and TDP-43 proteinopathies was established when intermediate CAG repeat expansions of ATXN2 gene had been discovered to be related to ALS and it was proven that ATXN2 modifies TDP-43 toxicity. Though ATXN2’s contribution to TDP-43 proteinopathies has been largely studied in ALS, current research have proven that intermediate repeat expansions of ATXN2 additionally affect the phenotype of FTLD by an unknown mechanism. To handle this difficulty, we immunohistochemically and biochemically analyzed the intracellular dynamics of ATXN2 in brains of regular controls and FTLD-TDP circumstances.
The immunohistochemical research revealed that ATXN2 localized within the neuronal cytoplasm and proximal dendrites, and expressed broadly and uniformly in regular human brains. A semi-quantitative immunofluorescent evaluation of regular brains revealed that the cytoplasmic ATXN2 strongly associates with ribosomal protein S6 and poly-A binding protein 1 and partially overlaps with the endoplasmic reticulum marker Calnexin, suggesting a serious function of ATXN2 in protein synthesis. The outcomes of immunohistochemical and biochemical analyses of brains from FTLD-TDP circumstances confirmed the colocalization of ATXN2 and phosphorylated TDP-43 within the dystrophic neurites and the neuronal cytoplasmic inclusions within the hippocampal area, and a major discount of ATXN2 protein in comparison with controls.
Ataxin 1 Antibody |
|||
AF6347-100ul | Affinity Biosciences | 100ul | EUR 280 |
Ataxin 1 Antibody |
|||
AF6347-200ul | Affinity Biosciences | 200ul | EUR 350 |
Ataxin 1 Antibody |
|||
ABF6347 | Lifescience Market | 100 ug | EUR 525.6 |
Ataxin-1 Antibody |
|||
E90506 | EnoGene | 100μg | EUR 255 |
Description: Available in various conjugation types. |
Ataxin 1 Antibody / ATXN1 |
|||
R32138 | NSJ Bioreagents | 100 ug | EUR 356.15 |
Description: Ataxin-1 is a protein that in humans is encoded by the ATXN1 gene. The ATXN1 gene had been mapped to 6p23 by in situ hybridization. Ataxin-1 (ATXN1), a causative factor for spinocerebellar ataxia type 1 (SCA1), and the related Brother of ATXN1 (BOAT1) are human proteins involved in transcriptional repression. ATXN1 and BOAT1 might participate in several Notch-controlled developmental and pathological processes. |
Ataxin-1 Polyclonal Antibody |
|||
ABP50719-003ml | Abbkine | 0.03ml | EUR 189.6 |
Description: A polyclonal antibody for detection of Ataxin-1 from Human, Mouse. This Ataxin-1 antibody is for WB , IHC-P, IF, ELISA. It is affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogenand is unconjugated. The antibody is produced in rabbit by using as an immunogen synthesized peptide derived from human Ataxin-1 around the non-phosphorylation site of S776 |
Ataxin-1 Polyclonal Antibody |
|||
ABP50719-01ml | Abbkine | 0.1ml | EUR 346.8 |
Description: A polyclonal antibody for detection of Ataxin-1 from Human, Mouse. This Ataxin-1 antibody is for WB , IHC-P, IF, ELISA. It is affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogenand is unconjugated. The antibody is produced in rabbit by using as an immunogen synthesized peptide derived from human Ataxin-1 around the non-phosphorylation site of S776 |
Ataxin-1 Polyclonal Antibody |
|||
ABP50719-02ml | Abbkine | 0.2ml | EUR 496.8 |
Description: A polyclonal antibody for detection of Ataxin-1 from Human, Mouse. This Ataxin-1 antibody is for WB , IHC-P, IF, ELISA. It is affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogenand is unconjugated. The antibody is produced in rabbit by using as an immunogen synthesized peptide derived from human Ataxin-1 around the non-phosphorylation site of S776 |
Ataxin-1 Polyclonal Antibody |
|||
40621-100ul | SAB | 100ul | EUR 302.4 |
Ataxin-1 Polyclonal Antibody |
|||
40621-50ul | SAB | 50ul | EUR 224.4 |
Ataxin-1 Polyclonal Antibody |
|||
E040621 | EnoGene | 100μg/100μl | EUR 255 |
Description: Available in various conjugation types. |
Ataxin-1 Polyclonal Antibody |
|||
E20-70373 | EnoGene | 100ug | EUR 225 |
Description: Available in various conjugation types. |
Ataxin-1 Polyclonal Antibody |
|||
E44H01617 | EnoGene | 100ul | EUR 255 |
Description: Biotin-Conjugated, FITC-Conjugated , AF350 Conjugated , AF405M-Conjugated ,AF488-Conjugated, AF514-Conjugated ,AF532-Conjugated, AF555-Conjugated ,AF568-Conjugated , HRP-Conjugated, AF405S-Conjugated, AF405L-Conjugated , AF546-Conjugated, AF594-Conjugated , AF610-Conjugated, AF635-Conjugated , AF647-Conjugated , AF680-Conjugated , AF700-Conjugated , AF750-Conjugated , AF790-Conjugated , APC-Conjugated , PE-Conjugated , Cy3-Conjugated , Cy5-Conjugated , Cy5.5-Conjugated , Cy7-Conjugated Antibody |
Ataxin 3 antibody |
|||
22437 | SAB | 100ul | EUR 479 |
Ataxin 3 antibody |
|||
22437-100ul | SAB | 100ul | EUR 468 |
Ataxin 3 Antibody |
|||
DF6375 | Affbiotech | 200ul | EUR 420 |
Ataxin 3 Antibody |
|||
DF6375-100ul | Affinity Biosciences | 100ul | EUR 280 |
Ataxin 3 Antibody |
|||
DF6375-200ul | Affinity Biosciences | 200ul | EUR 350 |
Ataxin 2 Antibody |
|||
E38PA2046 | EnoGene | 100ul | EUR 225 |
Description: Available in various conjugation types. |
Ataxin 10 Antibody |
|||
E38PA2595 | EnoGene | 100ul | EUR 225 |
Description: Available in various conjugation types. |
Ataxin 3 Antibody |
|||
E300595 | EnoGene | 100ug/200ul | EUR 275 |
Description: Available in various conjugation types. |
Ataxin 7 Antibody |
|||
E300596 | EnoGene | 100ug/200ul | EUR 275 |
Description: Available in various conjugation types. |
Ataxin 3 antibody |
|||
70R-13630 | Fitzgerald | 100 ul | EUR 548 |
Description: Affinity purified Rabbit polyclonal Ataxin 3 antibody |
Ataxin 10 antibody |
|||
70R-50914 | Fitzgerald | 100 ul | EUR 242 |
Description: Purified Polyclonal Ataxin 10 antibody |
Ataxin 2 antibody |
|||
70R-50365 | Fitzgerald | 100 ul | EUR 242 |
Description: Purified Polyclonal Ataxin 2 antibody |
Ataxin 1 (ATXN1) Antibody |
|||
20-abx100304 | Abbexa |
|
|
Ataxin 1 (ATXN1) Antibody |
|||
20-abx129635 | Abbexa |
|
|
Ataxin 1 (pS775) Antibody |
|||
20-abx121842 | Abbexa |
|
|
Ataxin 1 (ATXN1) Antibody |
|||
20-abx126836 | Abbexa |
|
|
Ataxin 1 (ATXN1) Antibody |
|||
abx145346-100ug | Abbexa | 100 ug | EUR 469.2 |
Ataxin 1 (ATXN1) Antibody |
|||
20-abx133167 | Abbexa |
|
|
Ataxin 1 (ATXN1) Antibody |
|||
abx031721-400ul | Abbexa | 400 ul | EUR 627.6 |
Ataxin 1 (ATXN1) Antibody |
|||
abx031721-80l | Abbexa | 80 µl | EUR 343.2 |
Ataxin 1 (ATXN1) Antibody |
|||
20-abx004749 | Abbexa |
|
|
Ataxin 1 (pS776) Antibody |
|||
abx010423-100ug | Abbexa | 100 ug | EUR 526.8 |
Ataxin 1 (ATXN1) Antibody |
|||
abx010425-100ul | Abbexa | 100 ul | EUR 493.2 |
Ataxin 1 (ATXN1) Antibody |
|||
20-abx242069 | Abbexa |
|
|
Ataxin 1 (ATXN1) Antibody |
|||
20-abx214569 | Abbexa |
|
|
Ataxin 1 (ATXN1) Antibody |
|||
20-abx171342 | Abbexa |
|
|
Ataxin 1 (ATXN1) Antibody |
|||
20-abx325351 | Abbexa |
|
|
Ataxin 1 (ATXN1) Antibody |
|||
abx431572-200ul | Abbexa | 200 ul | EUR 343.2 |
Ataxin 1 (ATXN1) Antibody |
|||
abx432383-200ul | Abbexa | 200 ul | EUR 343.2 |
Ataxin 1 (ATXN1) Antibody |
|||
abx445066-100ug | Abbexa | 100 ug | EUR 627.6 |
Ataxin 1 (ATXN1) Antibody |
|||
abx445084-100ug | Abbexa | 100 ug | EUR 627.6 |
Ataxin 1 (ATXN1) Antibody |
|||
20-abx320078 | Abbexa |
|
|
Ataxin 1 (pS775) Antibody |
|||
E38PA4341 | EnoGene | 100ul | EUR 225 |
Description: Available in various conjugation types. |
Ataxin 1 (ATXN1) Antibody |
|||
abx004749-100l | Abbexa | 100 µl | EUR 400 |
Ataxin 1 (ATXN1) Antibody |
|||
abx004749-20l | Abbexa | 20 µl | EUR 175 |
Ataxin 1 (ATXN1) Antibody |
|||
abx004749-50l | Abbexa | 50 µl | EUR 275 |
Ataxin 1 (ATXN1) Antibody |
|||
abx010425-100g | Abbexa | 100 µg | Ask for price |
Ataxin 1 (ATXN1) Antibody |
|||
abx010425-10g | Abbexa | 10 µg | EUR 362.5 |
Ataxin 1 (ATXN1) Antibody |
|||
abx010425-200g | Abbexa | 200 µg | Ask for price |
Ataxin 1 (ATXN1) Antibody |
|||
abx100304-100l | Abbexa | 100 µl | EUR 250 |
Ataxin 1 (ATXN1) Antibody |
|||
abx100304-1ml | Abbexa | 1 ml | EUR 675 |
Ataxin 1 (ATXN1) Antibody |
|||
abx100304-200l | Abbexa | 200 µl | EUR 312.5 |
Ataxin 1 (ATXN1) Antibody |
|||
abx129635-100l | Abbexa | 100 µl | EUR 262.5 |
Ataxin 1 (ATXN1) Antibody |
|||
abx129635-1ml | Abbexa | 1 ml | EUR 687.5 |
Ataxin 1 (ATXN1) Antibody |
|||
abx129635-200l | Abbexa | 200 µl | EUR 325 |
Ataxin 1 (ATXN1) Antibody |
|||
abx171342-1ml | Abbexa | 1 ml | EUR 712.5 |
Ataxin 1 (ATXN1) Antibody |
|||
abx031721-400l | Abbexa | 400 µl | EUR 518.75 |
Ataxin 1 (ATXN1) Antibody |
|||
abx242069-96tests | Abbexa | 96 tests | EUR 250 |
Ataxin 1 (ATXN1) Antibody |
|||
abx145346-1096tests | Abbexa | 10 × 96 tests | Ask for price |
Ataxin 1 (ATXN1) Antibody |
|||
abx145346-596tests | Abbexa | 5 × 96 tests | Ask for price |
Ataxin 1 (ATXN1) Antibody |
|||
abx145346-96tests | Abbexa | 96 tests | EUR 337.5 |
Ataxin 1 (ATXN1) Antibody |
|||
abx214569-100tests | Abbexa | 100 tests | EUR 350 |
Ataxin 1 (ATXN1) Antibody |
|||
abx214569-200tests | Abbexa | 200 tests | Ask for price |
Ataxin 1 (ATXN1) Antibody |
|||
abx214569-20tests | Abbexa | 20 tests | EUR 250 |
Ataxin 1 (ATXN1) Antibody |
|||
abx325351-100g | Abbexa | 100 µg | EUR 250 |
Ataxin 1 (ATXN1) Antibody |
|||
abx325351-50g | Abbexa | 50 µg | EUR 187.5 |
Ataxin 1 (ATXN1) Antibody |
|||
abx431572-200l | Abbexa | 200 µl | EUR 250 |
Ataxin 1 (ATXN1) Antibody |
|||
abx432383-100g | Abbexa | 100 µg | EUR 250 |
Ataxin 1 (ATXN1) Antibody |
|||
abx320078-100l | Abbexa | 100 µl | EUR 350 |
Ataxin 1 (ATXN1) Antibody |
|||
abx320078-50l | Abbexa | 50 µl | EUR 237.5 |
Ataxin 1 (ATXN1) Antibody |
|||
abx445066-100g | Abbexa | 100 µg | EUR 550 |
Ataxin 1 (ATXN1) Antibody |
|||
abx445084-100g | Abbexa | 100 µg | EUR 550 |
Ataxin-2 Antibody |
|||
R31210 | NSJ Bioreagents | 100 ug | EUR 356.15 |
Description: Ataxin-2, the protein encoded by the ATXN2 gene, contains a polyglutamine tract, long expansions (greater than 33 repeats) of which result in spinocerebellar ataxia-2 (SCA2), an autosomal dominant form of olivopontocerebellar atrophy. The gene for spinocerebellar ataxia type 2(SCA2) has been mapped to 12q24.1. Ataxin-2 associates with L- and T-plastin and overexpression leads to accumulation of T-plastin in mammalian cells. |
OASE00303-100UG - Ataxin 1 Antibody |
|||
OASE00303-100UG | Aviva Systems Biology | 100ug | EUR 429 |
OASE00321-100UG - Ataxin 1 Antibody |
|||
OASE00321-100UG | Aviva Systems Biology | 100ug | EUR 429 |
Rabbit Polyclonal Ataxin 1 Antibody |
|||
TA325245 | Origene Technologies GmbH | 100 µl | Ask for price |
Ataxin 1 Antibody, Clone S76-8 |
|||
SMC-455D | Stressmarq | 0.1mg | EUR 330 |
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical).
. The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is not conjugated. |
Ataxin 1 Antibody, Clone S76-8 |
|||
SMC-455S | Stressmarq | 0.012mg | EUR 44 |
Description: A monoclonal antibody from clone S76-8 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical).
. The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is not conjugated. |
Ataxin 1 Antibody, Clone S65-37 |
|||
SMC-475D | Stressmarq | 0.1mg | EUR 330 |
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical).
. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is not conjugated. |
Ataxin 1 Antibody, Clone S65-37 |
|||
SMC-475S | Stressmarq | 0.012mg | EUR 44 |
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical).
. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is not conjugated. |
Ataxin 1 (ATXN1) Polyclonal Antibody (Human, Mouse, Rat) |
|||
4-PAA514Hu01 | Cloud-Clone |
|
|
Description: A Rabbit polyclonal antibody against Human, Mouse, Rat Ataxin 1 (ATXN1) |
Ataxin 1 (Ab-776) Antibody |
|||
8B0771 | AAT Bioquest | 50ug | EUR 368 |
Description: Ataxin 1 (Ab-776) Antibody |
Ataxin 1 (ATXN1) Antibody (PE) |
|||
abx444428-100g | Abbexa | 100 µg | EUR 600 |
Ataxin 1 (ATXN1) Antibody (PE) |
|||
abx444446-100g | Abbexa | 100 µg | EUR 600 |
anti- Ataxin 2 antibody |
|||
FNab00657 | FN Test | 100µg | EUR 606.3 |
Description: Antibody raised against Ataxin 2 |
Rabbit Polyclonal antibody to Ataxin 3 (ataxin 3) |
|||
TA308320 | Origene Technologies GmbH | 100 µl | Ask for price |
Ataxin 1 (ATXN1) Antibody (ALP) |
|||
abx442463-100ug | Abbexa | 100 ug | EUR 693.6 |
Ataxin 1 (ATXN1) Antibody (ALP) |
|||
abx442481-100ug | Abbexa | 100 ug | EUR 693.6 |
Ataxin 1 (ATXN1) Antibody (APC) |
|||
abx442744-100ug | Abbexa | 100 ug | EUR 693.6 |
Ataxin 1 (ATXN1) Antibody (APC) |
|||
abx442762-100ug | Abbexa | 100 ug | EUR 693.6 |
Ataxin 1 (ATXN1) Antibody (HRP) |
|||
abx443585-100ug | Abbexa | 100 ug | EUR 678 |
Ataxin 1 (ATXN1) Antibody (HRP) |
|||
abx443603-100ug | Abbexa | 100 ug | EUR 678 |
Ataxin 1 (ATXN1) Antibody (RPE) |
|||
abx444428-100ug | Abbexa | 100 ug | EUR 693.6 |
Ataxin 1 (ATXN1) Antibody (RPE) |
|||
abx444446-100ug | Abbexa | 100 ug | EUR 693.6 |
Ataxin 1 (ATXN1) Antibody (APC) |
|||
abx442744-200g | Abbexa | 200 µg | EUR 612.5 |
Ataxin 1 (ATXN1) Antibody (APC) |
|||
abx442762-100l | Abbexa | 100 µl | EUR 612.5 |
Ataxin 1 (ATXN1) Antibody (HRP) |
|||
abx443585-100g | Abbexa | 100 µg | EUR 600 |
Ataxin 1 (ATXN1) Antibody (HRP) |
|||
abx443603-100g | Abbexa | 100 µg | EUR 600 |
Ataxin 3 Antibody / ATXN3 |
|||
F55027-0.08ML | NSJ Bioreagents | 0.08 ml | EUR 140.25 |
Description: ATXN3 was known as spinocerebellar ataxia-3, is an autosomal dominant neurologic disorder. The protein contains (CAG)n repeats in the coding region, and the expansion of these repeats from the normal 13-36 to 68-79 is one cause of Machado-Joseph disease. There is a negative correlation between the age of onset and CAG repeat numbers. |
Ataxin 3 Antibody / ATXN3 |
|||
F55027-0.4ML | NSJ Bioreagents | 0.4 ml | EUR 322.15 |
Description: ATXN3 was known as spinocerebellar ataxia-3, is an autosomal dominant neurologic disorder. The protein contains (CAG)n repeats in the coding region, and the expansion of these repeats from the normal 13-36 to 68-79 is one cause of Machado-Joseph disease. There is a negative correlation between the age of onset and CAG repeat numbers. |
Ataxin 3 Antibody / ATXN3 |
|||
R32137 | NSJ Bioreagents | 100 ug | EUR 356.15 |
Description: ATXN3 (Ataxin 3), also known as AT3, MJD GENE, MJD1, SCA3 GENE, ATX3, JOS, Spinocerebellar ataxia-3, Machado-Joseph disease protein 1, is a protein that in humans is encoded by the ATXN3 gene. ATXN3 ranges in size from 360 to 374 amino acids. Using Northern blot analysis showed that ATXN3 mRNA was ubiquitously expressed in human tissues. They detected at least 4 ATXN3 transcripts of 1.4, 1.8, 4.5, and 7.5 kb and suggested that the different mRNA species probably result from differential splicing and polyadenylation. Machado-Joseph disease, also known as spinocerebellar ataxia-3, is an autosomal dominant neurologic disorder. The protein encoded by the ATXN3 gene contains (CAG)n repeats in the coding region, and the expansion of these repeats from the normal 13-36 to 68-79 is the cause of Machado-Joseph disease. There is an inverse correlation between the age of onset and CAG repeat numbers. Alternatively spliced transcript variants encoding different isoforms have been described for this gene. Ataxin-3 interacted with 2 human homologs of the yeast DNA repair protein RAD23, HHR23A (RAD23A) and HHR23B (RAD23B). Both normal and mutant ataxin-3 proteins interacted with the ubiquitin-like domain at the N terminus of the HHR23 proteins, which is a motif important for nucleotide excision repair. However, in HEK 293 cells, HHR23A was recruited to intranuclear inclusions formed by the mutant ataxin-3 through its interaction with ataxin-3. |
Ataxin-1 Rabbit Polyclonal Antibody |
|||
ES1718-100ul | ELK Biotech | 100ul | EUR 124 |
Description: A Rabbit Polyclonal antibody against Ataxin-1 from Human/Mouse. This antibody is tested and validated for WB, ELISA, IHC, IF, WB, ELISA |
Ataxin-1 Rabbit Polyclonal Antibody |
|||
ES1718-50ul | ELK Biotech | 50ul | EUR 74 |
Description: A Rabbit Polyclonal antibody against Ataxin-1 from Human/Mouse. This antibody is tested and validated for WB, ELISA, IHC, IF, WB, ELISA |
Ataxin 1 (ATXN1) Antibody (FITC) |
|||
abx443304-100ug | Abbexa | 100 ug | EUR 678 |
Ataxin 1 (ATXN1) Antibody (FITC) |
|||
abx443322-100ug | Abbexa | 100 ug | EUR 678 |
Ataxin 1 (ATXN1) Antibody (FITC) |
|||
abx443304-100g | Abbexa | 100 µg | EUR 600 |
Ataxin 1 (ATXN1) Antibody (FITC) |
|||
abx443322-100g | Abbexa | 100 µg | EUR 600 |
Ataxin 1 Like (ATXN1L) Antibody |
|||
abx030547-400ul | Abbexa | 400 ul | EUR 627.6 |
Ataxin 1 Like (ATXN1L) Antibody |
|||
abx030547-80l | Abbexa | 80 µl | EUR 343.2 |
Ataxin 1 Like (ATXN1L) Antibody |
|||
20-abx301794 | Abbexa |
|
|
Ataxin 1 (ATXN1) Antibody (PerCP) |
|||
abx444147-100ug | Abbexa | 100 ug | EUR 693.6 |
Ataxin 1 (ATXN1) Antibody (PerCP) |
|||
abx444165-100ug | Abbexa | 100 ug | EUR 693.6 |
Ataxin 1 Like (ATXN1L) Antibody |
|||
abx301794-100g | Abbexa | 100 µg | EUR 362.5 |
Ataxin 1 Like (ATXN1L) Antibody |
|||
abx301794-20g | Abbexa | 20 µg | EUR 162.5 |
Ataxin 1 Like (ATXN1L) Antibody |
|||
abx301794-50g | Abbexa | 50 µg | EUR 250 |
Ataxin 1 Like (ATXN1L) Antibody |
|||
abx030547-400l | Abbexa | 400 µl | EUR 518.75 |
Ataxin 1 (ATXN1) Antibody (PerCP) |
|||
abx444147-100g | Abbexa | 100 µg | EUR 612.5 |
Ataxin 1 (ATXN1) Antibody (PerCP) |
|||
abx444165-100g | Abbexa | 100 µg | EUR 612.5 |
Ataxin 1 Antibody, Clone S76-8: APC |
|||
SMC-455D-APC | Stressmarq | 0.1mg | EUR 382 |
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical).
. The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with APC. |
Ataxin 1 Antibody, Clone S76-8: HRP |
|||
SMC-455D-HRP | Stressmarq | 0.1mg | EUR 370 |
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical).
. The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with HRP. |
Ataxin 1 Antibody, Clone S76-8: RPE |
|||
SMC-455D-RPE | Stressmarq | 0.1mg | EUR 380 |
Description: A monoclonal antibody from clone S76-8 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical).
. The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with RPE. |
Ataxin-2 Antibody / ATXN2 |
|||
R32313 | NSJ Bioreagents | 100 ug | EUR 356.15 |
Description: Ataxin-2, or ATX2, protein is encoded by the ATXN2 gene and contains a polyglutamine tract, long expansions (greater than 33 repeats) of which result in spinocerebellar ataxia-2 (SCA2), an autosomal dominant form of olivopontocerebellar atrophy. The gene for spinocerebellar ataxia type 2 (SCA2) has been mapped to 12q24.1. Ataxin-2 associates with L- and T-plastin and that overexpression of ataxin-2 leads to accumulation of T-plastin in mammalian cells. |
Ataxin 1 (ATXN1) Antibody (Biotin) |
|||
abx443024-100ug | Abbexa | 100 ug | EUR 693.6 |
Ataxin 1 (ATXN1) Antibody (Biotin) |
|||
abx443042-100ug | Abbexa | 100 ug | EUR 693.6 |
Ataxin 1 (ATXN1) Antibody (Biotin) |
|||
abx443024-100l | Abbexa | 100 µl | EUR 600 |
Ataxin 1 (ATXN1) Antibody (Biotin) |
|||
abx443042-400l | Abbexa | 400 µl | EUR 600 |
Ataxin 1 Antibody, Clone S76-8: FITC |
|||
SMC-455D-FITC | Stressmarq | 0.1mg | EUR 374 |
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical).
. The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with FITC. |
Ataxin 1 Antibody, Clone S65-37: APC |
|||
SMC-475D-APC | Stressmarq | 0.1mg | EUR 382 |
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical).
. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with APC. |
Ataxin 1 Antibody, Clone S65-37: HRP |
|||
SMC-475D-HRP | Stressmarq | 0.1mg | EUR 370 |
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical).
. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with HRP. |
Ataxin 1 Antibody, Clone S65-37: RPE |
|||
SMC-475D-RPE | Stressmarq | 0.1mg | EUR 380 |
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical).
. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with RPE. |
Ataxin 1 (ATXN1) Antibody (ATTO488) |
|||
abx440496-100g | Abbexa | 100 µg | EUR 612.5 |
Ataxin 1 (ATXN1) Antibody (ATTO488) |
|||
abx440514-100g | Abbexa | 100 µg | EUR 612.5 |
Ataxin 1 (ATXN1) Antibody (ATTO594) |
|||
abx441058-100g | Abbexa | 100 µg | EUR 612.5 |
Ataxin 1 (ATXN1) Antibody (ATTO594) |
|||
abx441076-100g | Abbexa | 100 µg | EUR 612.5 |
Ataxin 1 (ATXN1) Antibody (ATTO390) |
|||
abx440215-100g | Abbexa | 100 µg | EUR 612.5 |
Ataxin 1 (ATXN1) Antibody (ATTO390) |
|||
abx440233-100g | Abbexa | 100 µg | EUR 612.5 |
Ataxin 1 Antibody, Clone S76-8: PerCP |
|||
SMC-455D-PCP | Stressmarq | 0.1mg | EUR 382 |
Description: A monoclonal antibody from clone S76-8 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical).
. The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with PerCP. |
Ataxin 1 Antibody, Clone S65-37: FITC |
|||
SMC-475D-FITC | Stressmarq | 0.1mg | EUR 374 |
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical).
. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with FITC. |
Ataxin-1 Polyclonal Conjugated Antibody |
|||
C40621 | SAB | 100ul | EUR 476.4 |
Polyclonal Ataxin 10 Antibody |
|||
APG03169G | Leading Biology | 0.1ml | EUR 580.8 |
Description: A polyclonal antibody raised in Rabbit that recognizes and binds to Human Ataxin 10 . This antibody is tested and proven to work in the following applications: |
These outcomes counsel that ATXN2 is concerned within the pathological strategy of FTLD-TDP. It stays to be clarified whether or not decreased ATXN2 expression induces neurodegeneration by impairing protein synthesis or performs a neuroprotective function by attenuating the toxicity of TDP-43 aggregates in FTLD-TDP and different TDP-43 proteinopathies.