Background: Aberrations in Capicua (CIC) have lately been implicated as a adverse prognostic consider a mess of most cancers sorts by means of the derepression of targets downstream of the mitogen-activated protein kinase (MAPK) signaling cascade, similar to oncogenic E26 transformation-specific (ETS) transcription components. The Ataxin-family protein ATXN1L has beforehand been reported to work together with CIC in each developmental and illness contexts to facilitate the repression of CIC goal genes and promote the post-translational stability of CIC. Nevertheless, little is understood concerning the mechanisms on the base of ATXN1L-mediated CIC post-translational stability.
Outcomes: Useful in vitro research using ATXN1L human cell traces revealed that lack of ATXN1L results in the buildup of polyubiquitinated CIC protein, selling its degradation by means of the proteasome. Though transcriptomic signatures of ATXN1LKO cell traces indicated upregulation of the mitogen-activated protein kinase pathway, ERK exercise was discovered to contribute to CIC operate however not stability. Degradation of CIC protein following lack of ATXN1L was as an alternative noticed to be mediated by the E3 ubiquitin ligase TRIM25 which was additional validated utilizing glioma-derived cell traces and the TCGA breast carcinoma and liver hepatocellular carcinoma cohorts.
Conclusions: The post-translational regulation of CIC by means of ATXN1L and TRIM25 unbiased of ERK exercise means that the regulation of CIC stability and performance is extra intricate than beforehand appreciated and includes a number of unbiased pathways. As CIC standing has develop into a prognostic consider a number of most cancers sorts, additional data into the mechanisms which govern CIC stability and performance could show helpful for future therapeutic approaches.
Ataxin-2 Dysregulation Triggers a Compensatory Fragile X Psychological Retardation Protein Lower in Drosophila C4da Neurons
Dendrites require exact and well timed supply of protein substrates to distal areas to make sure the proper morphology and performance of neurons. Many of those protein substrates are equipped within the type of ribonucleoprotein (RNP) complicated consisting of RNA-binding proteins (RBPs) and mRNAs, that are subsequently translated in distal dendritic areas. It stays elusive, nonetheless, whether or not key RBPs provide mRNA in line with native calls for individually or in a coordinated method.
On this examine, we investigated how Drosophila sensory neurons reply to the dysregulation of a disease-associated RBP, Ataxin-2 (ATX2), which ends up in dendritic defects. We discovered that ATX2 performs an important function in spacing dendritic branches for the optimum dendritic receptive fields in Drosophila class IV dendritic arborization (C4da) neurons, the place each expression degree and subcellular location of ATX2 contribute considerably to this impact. We confirmed that translational upregulation by means of the expression of eukaryotic translation initiation issue 4E (eIF4E) additional enhanced the ATX2-induced dendritic phenotypes. Moreover, we discovered that the expression degree of one other disease-associated RBP, fragile X psychological retardation protein (FMRP), decreased in each cell our bodies and dendrites when neurons had been confronted with aberrant upregulation of ATX2. Lastly, we revealed that the PAM2 motif of ATX2, which mediates its interplay with poly(A)-binding protein (PABP), is probably mandatory for the lower of FMRP in sure neuronal stress situations.
Collectively, our knowledge counsel that dysregulation of RBPs triggers a compensatory regulation of different functionally-overlapping RBPs to reduce RBP dysregulation-associated aberrations that hinder neuronal homeostasis in dendrites. Lignin-carbohydrate complicated (LCC) is the organic macromolecule that has been demonstrated to exert a number of organic capabilities, together with antioxidant, anti-inflammation and anti-tumorigenesis, which help its broad utility within the bioengineering discipline. Nevertheless, it stays elusive the involvements of LCC in human neurological issues, particularly these with the overproduction of reactive oxygen species (ROS), similar to spinocerebellar ataxias (SCAs). On this examine, we discovered a beforehand undetermined anti-protein aggregation exercise of LCC.

TRIM25 promotes Capicua degradation independently of ERK in the absence of ATXN1L
Intracellular dynamics of Ataxin-2 within the human brains with regular and frontotemporal lobar degeneration with TDP-43 inclusions
TAR DNA-binding protein of 43 kDa (TDP-43) is a serious element of intracellular aggregates fashioned in brains of the sufferers with frontotemporal lobar degeneration (FTLD) and amyotrophic lateral sclerosis (ALS), that are correctively known as TDP-43 proteinopathies. A hyperlink between Ataxin-2 (ATXN2) and TDP-43 proteinopathies was established when intermediate CAG repeat expansions of ATXN2 gene had been discovered to be related to ALS and it was proven that ATXN2 modifies TDP-43 toxicity. Though ATXN2’s contribution to TDP-43 proteinopathies has been largely studied in ALS, current research have proven that intermediate repeat expansions of ATXN2 additionally affect the phenotype of FTLD by an unknown mechanism. To handle this difficulty, we immunohistochemically and biochemically analyzed the intracellular dynamics of ATXN2 in brains of regular controls and FTLD-TDP circumstances.
The immunohistochemical research revealed that ATXN2 localized within the neuronal cytoplasm and proximal dendrites, and expressed broadly and uniformly in regular human brains. A semi-quantitative immunofluorescent evaluation of regular brains revealed that the cytoplasmic ATXN2 strongly associates with ribosomal protein S6 and poly-A binding protein 1 and partially overlaps with the endoplasmic reticulum marker Calnexin, suggesting a serious function of ATXN2 in protein synthesis. The outcomes of immunohistochemical and biochemical analyses of brains from FTLD-TDP circumstances confirmed the colocalization of ATXN2 and phosphorylated TDP-43 within the dystrophic neurites and the neuronal cytoplasmic inclusions within the hippocampal area, and a major discount of ATXN2 protein in comparison with controls.
![]() Ataxin-1 Polyclonal Antibody |
|||
ABP50719-02ml | Abbkine | 0.2ml | EUR 414 |
Description: A polyclonal antibody for detection of Ataxin-1 from Human, Mouse. This Ataxin-1 antibody is for WB , IHC-P, IF, ELISA. It is affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogenand is unconjugated. The antibody is produced in rabbit by using as an immunogen synthesized peptide derived from human Ataxin-1 around the non-phosphorylation site of S776 |
![]() Ataxin 1 (ATXN1) Antibody |
|||
20-abx126836 | Abbexa |
|
|
![]() Ataxin 1 (ATXN1) Antibody |
|||
20-abx129635 | Abbexa |
|
|
![]() Ataxin 1 (pS775) Antibody |
|||
20-abx121842 | Abbexa |
|
|
![]() Ataxin 1 (ATXN1) Antibody |
|||
20-abx320078 | Abbexa |
|
|
![]() Ataxin 1 (ATXN1) Antibody |
|||
abx431572-200ul | Abbexa | 200 ul | EUR 286 |
![]() Ataxin 1 (ATXN1) Antibody |
|||
abx432383-200ul | Abbexa | 200 ul | EUR 286 |
![]() Ataxin 1 (ATXN1) Antibody |
|||
abx445066-100ug | Abbexa | 100 ug | EUR 523 |
![]() Ataxin 1 (ATXN1) Antibody |
|||
abx445084-100ug | Abbexa | 100 ug | EUR 523 |
![]() Ataxin 1 (ATXN1) Antibody |
|||
20-abx242069 | Abbexa |
|
|
![]() Ataxin 1 (ATXN1) Antibody |
|||
20-abx214569 | Abbexa |
|
|
![]() Ataxin 1 (ATXN1) Antibody |
|||
20-abx171342 | Abbexa |
|
|
![]() Ataxin 1 (ATXN1) Antibody |
|||
20-abx325351 | Abbexa |
|
|
![]() Ataxin 1 (ATXN1) Antibody |
|||
20-abx004749 | Abbexa |
|
|
![]() Ataxin 1 (ATXN1) Antibody |
|||
20-abx100304 | Abbexa |
|
|
![]() Ataxin 1 (ATXN1) Antibody |
|||
20-abx133167 | Abbexa |
|
|
![]() Ataxin 1 (ATXN1) Antibody |
|||
abx145346-100ug | Abbexa | 100 ug | EUR 391 |
![]() Ataxin 1 (pS776) Antibody |
|||
abx010423-100ug | Abbexa | 100 ug | EUR 439 |
![]() Ataxin 1 (ATXN1) Antibody |
|||
abx010425-100ul | Abbexa | 100 ul | EUR 411 |
![]() Ataxin 1 (ATXN1) Antibody |
|||
abx031721-400ul | Abbexa | 400 ul | EUR 523 |
![]() Ataxin 1 (ATXN1) Antibody |
|||
abx031721-80l | Abbexa | 80 µl | EUR 286 |
![]() Ataxin-1 Polyclonal Antibody |
|||
ES1718-100ul | ELK Biotech | 100ul | EUR 279 |
Description: A Rabbit Polyclonal antibody against Ataxin-1 from Human/Mouse. This antibody is tested and validated for WB, ELISA, IHC, IF, WB, ELISA |
![]() Ataxin-1 Polyclonal Antibody |
|||
ES1718-50ul | ELK Biotech | 50ul | EUR 207 |
Description: A Rabbit Polyclonal antibody against Ataxin-1 from Human/Mouse. This antibody is tested and validated for WB, ELISA, IHC, IF, WB, ELISA |
![]() Anti-Ataxin-1 antibody |
|||
STJ97853 | St John's Laboratory | 100 µl | EUR 234 |
Description: Mouse monoclonal to Ataxin-1. |
![]() Anti-Ataxin-1 antibody |
|||
STJ91738 | St John's Laboratory | 200 µl | EUR 197 |
Description: Rabbit polyclonal to Ataxin-1. |
![]() Ataxin-1 Polyclonal Antibody |
|||
40621-100ul | SAB | 100ul | EUR 252 |
![]() Ataxin-1 Polyclonal Antibody |
|||
40621-50ul | SAB | 50ul | EUR 187 |
![]() Human Ataxin 1 ELISA kit |
|||
E01A0540-192T | BlueGene | 192 tests | EUR 1270 |
Description: A competitive ELISA for quantitative measurement of Human Ataxin 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
![]() Human Ataxin 1 ELISA kit |
|||
E01A0540-48 | BlueGene | 1 plate of 48 wells | EUR 520 |
Description: A competitive ELISA for quantitative measurement of Human Ataxin 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
![]() Human Ataxin 1 ELISA kit |
|||
E01A0540-96 | BlueGene | 1 plate of 96 wells | EUR 685 |
Description: A competitive ELISA for quantitative measurement of Human Ataxin 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
![]() Human Ataxin 1 (ATXN1) Protein |
|||
20-abx065471 | Abbexa |
|
|
![]() Phospho-Ataxin 1 (Ser775) Antibody |
|||
AF3347 | Affbiotech | 200ul | EUR 304 |
Description: Phospho-Ataxin 1 (Ser775) Antibody detects endogenous levels of Ataxin 1 only when phosphorylated at Serine 775. |
![]() Phospho- Ataxin 1 (Ser775) Antibody |
|||
ABF3347 | Lifescience Market | 100 ug | EUR 438 |
![]() Ataxin 1 (ATXN1) Antibody (ALP) |
|||
abx442463-100ug | Abbexa | 100 ug | EUR 578 |
![]() Ataxin 1 (ATXN1) Antibody (ALP) |
|||
abx442481-100ug | Abbexa | 100 ug | EUR 578 |
![]() Ataxin 1 (ATXN1) Antibody (APC) |
|||
abx442744-100ug | Abbexa | 100 ug | EUR 578 |
![]() Ataxin 1 (ATXN1) Antibody (APC) |
|||
abx442762-100ug | Abbexa | 100 ug | EUR 578 |
![]() Ataxin 1 (ATXN1) Antibody (Biotin) |
|||
abx443024-100ug | Abbexa | 100 ug | EUR 578 |
![]() Ataxin 1 (ATXN1) Antibody (Biotin) |
|||
abx443042-100ug | Abbexa | 100 ug | EUR 578 |
![]() Ataxin 1 (ATXN1) Antibody (FITC) |
|||
abx443304-100ug | Abbexa | 100 ug | EUR 565 |
![]() Ataxin 1 (ATXN1) Antibody (FITC) |
|||
abx443322-100ug | Abbexa | 100 ug | EUR 565 |
![]() Ataxin 1 (ATXN1) Antibody (HRP) |
|||
abx443585-100ug | Abbexa | 100 ug | EUR 565 |
![]() Ataxin 1 (ATXN1) Antibody (HRP) |
|||
abx443603-100ug | Abbexa | 100 ug | EUR 565 |
![]() Ataxin 1 (ATXN1) Antibody (PerCP) |
|||
abx444147-100ug | Abbexa | 100 ug | EUR 578 |
![]() Ataxin 1 (ATXN1) Antibody (PerCP) |
|||
abx444165-100ug | Abbexa | 100 ug | EUR 578 |
![]() Ataxin 1 (ATXN1) Antibody (RPE) |
|||
abx444428-100ug | Abbexa | 100 ug | EUR 578 |
![]() Ataxin 1 (ATXN1) Antibody (RPE) |
|||
abx444446-100ug | Abbexa | 100 ug | EUR 578 |
![]() Ataxin 1 (ATXN1) Antibody (Streptavidin) |
|||
abx444709-100ug | Abbexa | 100 ug | EUR 578 |
![]() Ataxin 1 (ATXN1) Antibody (Streptavidin) |
|||
abx444727-100ug | Abbexa | 100 ug | EUR 578 |
![]() Ataxin 1 Like (ATXN1L) Antibody |
|||
20-abx301794 | Abbexa |
|
|
![]() Ataxin 1 Like (ATXN1L) Antibody |
|||
abx030547-400ul | Abbexa | 400 ul | EUR 523 |
![]() Ataxin 1 Like (ATXN1L) Antibody |
|||
abx030547-80l | Abbexa | 80 µl | EUR 286 |
![]() Ataxin 1 (Phospho-Ser776) Antibody |
|||
12034-100ul | SAB | 100ul | EUR 252 |
![]() Ataxin 1 (Phospho-Ser776) Antibody |
|||
12034-50ul | SAB | 50ul | EUR 187 |
![]() Monoclonal antibody for Ataxin 1 |
|||
SMC-455D | Stressmarq | 0.1mg | EUR 353 |
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical).
. The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is not conjugated. |
![]() Monoclonal antibody for Ataxin 1 |
|||
SMC-455D-A390 | Stressmarq | 0.1mg | EUR 400 |
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical).
. The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with ATTO 390. |
![]() Monoclonal antibody for Ataxin 1 |
|||
SMC-455D-A488 | Stressmarq | 0.1mg | EUR 399 |
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical).
. The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with ATTO 488. |
![]() Monoclonal antibody for Ataxin 1 |
|||
SMC-455D-A565 | Stressmarq | 0.1mg | EUR 399 |
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical).
. The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with ATTO 565. |
![]() Monoclonal antibody for Ataxin 1 |
|||
SMC-455D-A594 | Stressmarq | 0.1mg | EUR 399 |
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical).
. The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with ATTO 594. |
![]() Monoclonal antibody for Ataxin 1 |
|||
SMC-455D-A633 | Stressmarq | 0.1mg | EUR 399 |
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical).
. The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with ATTO 633. |
![]() Monoclonal antibody for Ataxin 1 |
|||
SMC-455D-A655 | Stressmarq | 0.1mg | EUR 399 |
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical).
. The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with ATTO 655. |
![]() Monoclonal antibody for Ataxin 1 |
|||
SMC-455D-A680 | Stressmarq | 0.1mg | EUR 399 |
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical).
. The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with ATTO 680. |
![]() Monoclonal antibody for Ataxin 1 |
|||
SMC-455D-A700 | Stressmarq | 0.1mg | EUR 399 |
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical).
. The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with ATTO 700. |
![]() Monoclonal antibody for Ataxin 1 |
|||
SMC-455D-ALP | Stressmarq | 0.1mg | EUR 393 |
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical).
. The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with Alkaline Phosphatase. |
![]() Monoclonal antibody for Ataxin 1 |
|||
SMC-455D-APC | Stressmarq | 0.1mg | EUR 398 |
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical).
. The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with APC. |
![]() Monoclonal antibody for Ataxin 1 |
|||
SMC-455D-APCCY7 | Stressmarq | 0.1mg | EUR 470 |
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical).
. The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with APC/Cy7. |
![]() Monoclonal antibody for Ataxin 1 |
|||
SMC-455D-BI | Stressmarq | 0.1mg | EUR 395 |
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical).
. The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with Biotin. |
![]() Monoclonal antibody for Ataxin 1 |
|||
SMC-455D-DY350 | Stressmarq | 0.1mg | EUR 413 |
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical).
. The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with Dylight 350. |
![]() Monoclonal antibody for Ataxin 1 |
|||
SMC-455D-DY405 | Stressmarq | 0.1mg | EUR 402 |
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical).
. The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with Dylight 405. |
![]() Monoclonal antibody for Ataxin 1 |
|||
SMC-455D-DY488 | Stressmarq | 0.1mg | EUR 392 |
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical).
. The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with Dylight 488. |
![]() Monoclonal antibody for Ataxin 1 |
|||
SMC-455D-DY594 | Stressmarq | 0.1mg | EUR 394 |
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical).
. The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with Dylight 594. |
![]() Monoclonal antibody for Ataxin 1 |
|||
SMC-455D-DY633 | Stressmarq | 0.1mg | EUR 389 |
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical).
. The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with Dylight 633. |
![]() Monoclonal antibody for Ataxin 1 |
|||
SMC-455D-FITC | Stressmarq | 0.1mg | EUR 391 |
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical).
. The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with FITC. |
![]() Monoclonal antibody for Ataxin 1 |
|||
SMC-455D-HRP | Stressmarq | 0.1mg | EUR 387 |
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical).
. The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with HRP. |
![]() Monoclonal antibody for Ataxin 1 |
|||
SMC-455D-P594 | Stressmarq | 0.1mg | EUR 406 |
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical).
. The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with PE/ATTO 594. |
![]() Monoclonal antibody for Ataxin 1 |
|||
SMC-455D-PCP | Stressmarq | 0.1mg | EUR 398 |
Description: A monoclonal antibody from clone S76-8 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical).
. The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with PerCP. |
![]() Monoclonal antibody for Ataxin 1 |
|||
SMC-455D-RPE | Stressmarq | 0.1mg | EUR 396 |
Description: A monoclonal antibody from clone S76-8 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical).
. The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with RPE. |
![]() Monoclonal antibody for Ataxin 1 |
|||
SMC-455D-STR | Stressmarq | 0.1mg | EUR 397 |
Description: A monoclonal antibody from clone S76-8 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical).
. The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with Streptavidin. |
![]() Monoclonal antibody for Ataxin 1 |
|||
SMC-455S | Stressmarq | 0.012mg | EUR 65 |
Description: A monoclonal antibody from clone S76-8 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical).
. The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is not conjugated. |
![]() Monoclonal antibody for Ataxin 1 |
|||
SMC-475D | Stressmarq | 0.1mg | EUR 353 |
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical).
. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is not conjugated. |
![]() Monoclonal antibody for Ataxin 1 |
|||
SMC-475D-A390 | Stressmarq | 0.1mg | EUR 400 |
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical).
. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with ATTO 390. |
![]() Monoclonal antibody for Ataxin 1 |
|||
SMC-475D-A488 | Stressmarq | 0.1mg | EUR 399 |
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical).
. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with ATTO 488. |
![]() Monoclonal antibody for Ataxin 1 |
|||
SMC-475D-A565 | Stressmarq | 0.1mg | EUR 399 |
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical).
. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with ATTO 565. |
![]() Monoclonal antibody for Ataxin 1 |
|||
SMC-475D-A594 | Stressmarq | 0.1mg | EUR 399 |
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical).
. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with ATTO 594. |
![]() Monoclonal antibody for Ataxin 1 |
|||
SMC-475D-A633 | Stressmarq | 0.1mg | EUR 399 |
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical).
. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with ATTO 633. |
![]() Monoclonal antibody for Ataxin 1 |
|||
SMC-475D-A655 | Stressmarq | 0.1mg | EUR 399 |
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical).
. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with ATTO 655. |
![]() Monoclonal antibody for Ataxin 1 |
|||
SMC-475D-A680 | Stressmarq | 0.1mg | EUR 399 |
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical).
. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with ATTO 680. |
![]() Monoclonal antibody for Ataxin 1 |
|||
SMC-475D-A700 | Stressmarq | 0.1mg | EUR 399 |
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical).
. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with ATTO 700. |
![]() Monoclonal antibody for Ataxin 1 |
|||
SMC-475D-ALP | Stressmarq | 0.1mg | EUR 393 |
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical).
. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with Alkaline Phosphatase. |
![]() Monoclonal antibody for Ataxin 1 |
|||
SMC-475D-APC | Stressmarq | 0.1mg | EUR 398 |
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical).
. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with APC. |
![]() Monoclonal antibody for Ataxin 1 |
|||
SMC-475D-APCCY7 | Stressmarq | 0.1mg | EUR 470 |
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical).
. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with APC/Cy7. |
![]() Monoclonal antibody for Ataxin 1 |
|||
SMC-475D-BI | Stressmarq | 0.1mg | EUR 395 |
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical).
. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with Biotin. |
![]() Monoclonal antibody for Ataxin 1 |
|||
SMC-475D-DY350 | Stressmarq | 0.1mg | EUR 413 |
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical).
. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with Dylight 350. |
![]() Monoclonal antibody for Ataxin 1 |
|||
SMC-475D-DY405 | Stressmarq | 0.1mg | EUR 402 |
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical).
. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with Dylight 405. |
![]() Monoclonal antibody for Ataxin 1 |
|||
SMC-475D-DY488 | Stressmarq | 0.1mg | EUR 392 |
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical).
. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with Dylight 488. |
![]() Monoclonal antibody for Ataxin 1 |
|||
SMC-475D-DY594 | Stressmarq | 0.1mg | EUR 394 |
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical).
. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with Dylight 594. |
![]() Monoclonal antibody for Ataxin 1 |
|||
SMC-475D-DY633 | Stressmarq | 0.1mg | EUR 389 |
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical).
. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with Dylight 633. |
![]() Monoclonal antibody for Ataxin 1 |
|||
SMC-475D-FITC | Stressmarq | 0.1mg | EUR 391 |
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical).
. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with FITC. |
![]() Monoclonal antibody for Ataxin 1 |
|||
SMC-475D-HRP | Stressmarq | 0.1mg | EUR 387 |
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical).
. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with HRP. |
![]() Monoclonal antibody for Ataxin 1 |
|||
SMC-475D-P594 | Stressmarq | 0.1mg | EUR 406 |
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical).
. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with PE/ATTO 594. |
![]() Monoclonal antibody for Ataxin 1 |
|||
SMC-475D-PCP | Stressmarq | 0.1mg | EUR 398 |
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical).
. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with PerCP. |
![]() Monoclonal antibody for Ataxin 1 |
|||
SMC-475D-RPE | Stressmarq | 0.1mg | EUR 396 |
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical).
. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with RPE. |
![]() Monoclonal antibody for Ataxin 1 |
|||
SMC-475D-STR | Stressmarq | 0.1mg | EUR 397 |
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical).
. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with Streptavidin. |
![]() Monoclonal antibody for Ataxin 1 |
|||
SMC-475S | Stressmarq | 0.012mg | EUR 65 |
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical).
. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is not conjugated. |
![]() Anti-Ataxin 1/ATXN1 Antibody |
|||
PA2097 | BosterBio | 100ug/vial | EUR 294 |
![]() Anti-Ataxin 1/ATXN1 Antibody |
|||
PB9422 | BosterBio | 100ug/vial | EUR 334 |
![]() Ataxin-1 Polyclonal Conjugated Antibody |
|||
C40621 | SAB | 100ul | EUR 397 |
![]() Ataxin 1 Blocking Peptide |
|||
AF6347-BP | Affbiotech | 1mg | EUR 195 |
![]() Anti-Ataxin 1 (4C5) |
|||
YF-MA15341 | Abfrontier | 100 ug | EUR 363 |
Description: Mouse monoclonal to Ataxin 1 |
![]() Recombinant Ataxin 1 (ATXN1) |
|||
4-RPA514Hu01 | Cloud-Clone |
|
|
Description: Recombinant Human Ataxin 1 expressed in: E.coli |
![]() Recombinant Ataxin 1 (ATXN1) |
|||
4-RPA514Mu01 | Cloud-Clone |
|
|
Description: Recombinant Mouse Ataxin 1 expressed in: E.coli |
![]() Ataxin 1 Blocking Peptide |
|||
20-abx161786 | Abbexa |
|
|
![]() Ataxin 2 antibody |
|||
70R-50365 | Fitzgerald | 100 ul | EUR 244 |
Description: Purified Polyclonal Ataxin 2 antibody |
![]() Ataxin 10 antibody |
|||
70R-50914 | Fitzgerald | 100 ul | EUR 244 |
Description: Purified Polyclonal Ataxin 10 antibody |
![]() Ataxin 3 antibody |
|||
70R-13630 | Fitzgerald | 100 ul | EUR 457 |
Description: Affinity purified Rabbit polyclonal Ataxin 3 antibody |
![]() Ataxin 3 antibody |
|||
22437-100ul | SAB | 100ul | EUR 390 |
![]() Human Ataxin- 1, ATXN1 ELISA KIT |
|||
ELI-11425h | Lifescience Market | 96 Tests | EUR 824 |
![]() Human Ataxin 1 (ATXN1) ELISA Kit |
|||
abx572392-96tests | Abbexa | 96 tests | EUR 668 |
![]() Human Ataxin 1 (ATXN1) CLIA Kit |
|||
abx196467-96tests | Abbexa | 96 tests | EUR 825 |
![]() Human Ataxin 1 (ATXN1) ELISA Kit |
|||
DLR-ATXN1-Hu-48T | DL Develop | 48T | EUR 479 |
Description: A sandwich quantitative ELISA assay kit for detection of Human Ataxin 1 (ATXN1) in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids. |
![]() Human Ataxin 1 (ATXN1) ELISA Kit |
|||
DLR-ATXN1-Hu-96T | DL Develop | 96T | EUR 621 |
Description: A sandwich quantitative ELISA assay kit for detection of Human Ataxin 1 (ATXN1) in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids. |
![]() Human Ataxin 1 (ATXN1) ELISA Kit |
|||
RD-ATXN1-Hu-48Tests | Reddot Biotech | 48 Tests | EUR 478 |
![]() Human Ataxin 1 (ATXN1) ELISA Kit |
|||
RD-ATXN1-Hu-96Tests | Reddot Biotech | 96 Tests | EUR 662 |
![]() Human Ataxin 1 (ATXN1) ELISA Kit |
|||
RDR-ATXN1-Hu-48Tests | Reddot Biotech | 48 Tests | EUR 500 |
![]() Human Ataxin 1 (ATXN1) ELISA Kit |
|||
RDR-ATXN1-Hu-96Tests | Reddot Biotech | 96 Tests | EUR 692 |
![]() Human ATXN1(Ataxin 1) ELISA Kit |
|||
EH2682 | FN Test | 96T | EUR 524.1 |
Description: Method of detection: Double Antibody, Sandwich ELISA;Reacts with: Homo sapiens;Sensitivity: 0.188 ng/ml |
![]() Human Ataxin 1(ATXN1)ELISA Kit |
|||
QY-E01561 | Qayee Biotechnology | 96T | EUR 361 |
![]() Ataxin 1 (ATXN1) Polyclonal Antibody (Mouse) |
|||
4-PAA514Mu01 | Cloud-Clone |
|
|
Description: A Rabbit polyclonal antibody against Mouse Ataxin 1 (ATXN1) |
![]() Ataxin-1 (phospho Ser776) Polyclonal Antibody |
|||
ABP56120-003ml | Abbkine | 0.03ml | EUR 158 |
Description: A polyclonal antibody for detection of Ataxin-1 phospho Ser776) from Human, Mouse. This Ataxin-1 phospho Ser776) antibody is for WB, IHC-P, IF, ELISA. It is affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogenand is unconjugated. The antibody is produced in rabbit by using as an immunogen synthesized peptide derived from human Ataxin-1 around the phosphorylation site of S776 |
![]() Ataxin-1 (phospho Ser776) Polyclonal Antibody |
|||
ABP56120-01ml | Abbkine | 0.1ml | EUR 289 |
Description: A polyclonal antibody for detection of Ataxin-1 phospho Ser776) from Human, Mouse. This Ataxin-1 phospho Ser776) antibody is for WB, IHC-P, IF, ELISA. It is affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogenand is unconjugated. The antibody is produced in rabbit by using as an immunogen synthesized peptide derived from human Ataxin-1 around the phosphorylation site of S776 |
![]() Ataxin-1 (phospho Ser776) Polyclonal Antibody |
|||
ABP56120-02ml | Abbkine | 0.2ml | EUR 414 |
Description: A polyclonal antibody for detection of Ataxin-1 phospho Ser776) from Human, Mouse. This Ataxin-1 phospho Ser776) antibody is for WB, IHC-P, IF, ELISA. It is affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogenand is unconjugated. The antibody is produced in rabbit by using as an immunogen synthesized peptide derived from human Ataxin-1 around the phosphorylation site of S776 |
![]() Ataxin 1 Like (ATXN1L) Antibody (HRP) |
|||
20-abx314758 | Abbexa |
|
|
![]() Ataxin 1 Like (ATXN1L) Antibody (FITC) |
|||
20-abx314759 | Abbexa |
|
|
![]() Ataxin 1 Like (ATXN1L) Antibody (Biotin) |
|||
20-abx314760 | Abbexa |
|
|
![]() Ataxin 1 (ATXN1) Antibody (ATTO 390) |
|||
abx440215-100ug | Abbexa | 100 ug | EUR 578 |
![]() Ataxin 1 (ATXN1) Antibody (ATTO 390) |
|||
abx440233-100ug | Abbexa | 100 ug | EUR 578 |
![]() Ataxin 1 (ATXN1) Antibody (ATTO 488) |
|||
abx440496-100ug | Abbexa | 100 ug | EUR 578 |
![]() Ataxin 1 (ATXN1) Antibody (ATTO 488) |
|||
abx440514-100ug | Abbexa | 100 ug | EUR 578 |
![]() Ataxin 1 (ATXN1) Antibody (ATTO 565) |
|||
abx440777-100ug | Abbexa | 100 ug | EUR 578 |
![]() Ataxin 1 (ATXN1) Antibody (ATTO 565) |
|||
abx440795-100ug | Abbexa | 100 ug | EUR 578 |
![]() Ataxin 1 (ATXN1) Antibody (ATTO 594) |
|||
abx441058-100ug | Abbexa | 100 ug | EUR 578 |
![]() Ataxin 1 (ATXN1) Antibody (ATTO 594) |
|||
abx441076-100ug | Abbexa | 100 ug | EUR 578 |
![]() Ataxin 1 (ATXN1) Antibody (ATTO 633) |
|||
abx441339-100ug | Abbexa | 100 ug | EUR 578 |
These outcomes counsel that ATXN2 is concerned within the pathological strategy of FTLD-TDP. It stays to be clarified whether or not decreased ATXN2 expression induces neurodegeneration by impairing protein synthesis or performs a neuroprotective function by attenuating the toxicity of TDP-43 aggregates in FTLD-TDP and different TDP-43 proteinopathies.