Background: Aberrations in Capicua (CIC) have lately been implicated as a adverse prognostic consider a mess of most cancers sorts by means of the derepression of targets downstream of the mitogen-activated protein kinase (MAPK) signaling cascade, similar to oncogenic E26 transformation-specific (ETS) transcription components. The Ataxin-family protein ATXN1L has beforehand been reported to work together with CIC in each developmental and illness contexts to facilitate the repression of CIC goal genes and promote the post-translational stability of CIC. Nevertheless, little is understood concerning the mechanisms on the base of ATXN1L-mediated CIC post-translational stability.

Outcomes: Useful in vitro research using ATXN1L human cell traces revealed that lack of ATXN1L results in the buildup of polyubiquitinated CIC protein, selling its degradation by means of the proteasome. Though transcriptomic signatures of ATXN1L^KO cell traces indicated upregulation of the mitogen-activated protein kinase pathway, ERK exercise was discovered to contribute to CIC operate however not stability. Degradation of CIC protein following lack of ATXN1L was as an alternative noticed to be mediated by the E3 ubiquitin ligase TRIM25 which was additional validated utilizing glioma-derived cell traces and the TCGA breast carcinoma and liver hepatocellular carcinoma cohorts.

Conclusions: The post-translational regulation of CIC by means of ATXN1L and TRIM25 unbiased of ERK exercise means that the regulation of CIC stability and performance is extra intricate than beforehand appreciated and includes a number of unbiased pathways. As CIC standing has develop into a prognostic consider a number of most cancers sorts, additional data into the mechanisms which govern CIC stability and performance could show helpful for future therapeutic approaches.

Dendrites require exact and well timed supply of protein substrates to distal areas to make sure the proper morphology and performance of neurons. Many of those protein substrates are equipped within the type of ribonucleoprotein (RNP) complicated consisting of RNA-binding proteins (RBPs) and mRNAs, that are subsequently translated in distal dendritic areas. It stays elusive, nonetheless, whether or not key RBPs provide mRNA in line with native calls for individually or in a coordinated method.

On this examine, we investigated how Drosophila sensory neurons reply to the dysregulation of a disease-associated RBP, Ataxin-2 (ATX2), which ends up in dendritic defects. We discovered that ATX2 performs an important function in spacing dendritic branches for the optimum dendritic receptive fields in Drosophila class IV dendritic arborization (C4da) neurons, the place each expression degree and subcellular location of ATX2 contribute considerably to this impact. We confirmed that translational upregulation by means of the expression of eukaryotic translation initiation issue 4E (eIF4E) additional enhanced the ATX2-induced dendritic phenotypes. Moreover, we discovered that the expression degree of one other disease-associated RBP, fragile X psychological retardation protein (FMRP), decreased in each cell our bodies and dendrites when neurons had been confronted with aberrant upregulation of ATX2. Lastly, we revealed that the PAM2 motif of ATX2, which mediates its interplay with poly(A)-binding protein (PABP), is probably mandatory for the lower of FMRP in sure neuronal stress situations.

Collectively, our knowledge counsel that dysregulation of RBPs triggers a compensatory regulation of different functionally-overlapping RBPs to reduce RBP dysregulation-associated aberrations that hinder neuronal homeostasis in dendrites. Lignin-carbohydrate complicated (LCC) is the organic macromolecule that has been demonstrated to exert a number of organic capabilities, together with antioxidant, anti-inflammation and anti-tumorigenesis, which help its broad utility within the bioengineering discipline. Nevertheless, it stays elusive the involvements of LCC in human neurological issues, particularly these with the overproduction of reactive oxygen species (ROS), similar to spinocerebellar ataxias (SCAs). On this examine, we discovered a beforehand undetermined anti-protein aggregation exercise of LCC.

TAR DNA-binding protein of 43 kDa (TDP-43) is a serious element of intracellular aggregates fashioned in brains of the sufferers with frontotemporal lobar degeneration (FTLD) and amyotrophic lateral sclerosis (ALS), that are correctively known as TDP-43 proteinopathies. A hyperlink between Ataxin-2 (ATXN2) and TDP-43 proteinopathies was established when intermediate CAG repeat expansions of ATXN2 gene had been discovered to be related to ALS and it was proven that ATXN2 modifies TDP-43 toxicity. Though ATXN2’s contribution to TDP-43 proteinopathies has been largely studied in ALS, current research have proven that intermediate repeat expansions of ATXN2 additionally affect the phenotype of FTLD by an unknown mechanism. To handle this difficulty, we immunohistochemically and biochemically analyzed the intracellular dynamics of ATXN2 in brains of regular controls and FTLD-TDP circumstances.

The immunohistochemical research revealed that ATXN2 localized within the neuronal cytoplasm and proximal dendrites, and expressed broadly and uniformly in regular human brains. A semi-quantitative immunofluorescent evaluation of regular brains revealed that the cytoplasmic ATXN2 strongly associates with ribosomal protein S6 and poly-A binding protein 1 and partially overlaps with the endoplasmic reticulum marker Calnexin, suggesting a serious function of ATXN2 in protein synthesis. The outcomes of immunohistochemical and biochemical analyses of brains from FTLD-TDP circumstances confirmed the colocalization of ATXN2 and phosphorylated TDP-43 within the dystrophic neurites and the neuronal cytoplasmic inclusions within the hippocampal area, and a major discount of ATXN2 protein in comparison with controls.

Ataxin-1 Polyclonal Antibody
40621-50ul	SAB	50ul	EUR 224.4

Ataxin-1 Polyclonal Antibody
ABP50719-003ml	Abbkine	0.03ml	EUR 189.6
Description: A polyclonal antibody for detection of Ataxin-1 from Human, Mouse. This Ataxin-1 antibody is for WB , IHC-P, IF, ELISA. It is affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogenand is unconjugated. The antibody is produced in rabbit by using as an immunogen synthesized peptide derived from human Ataxin-1 around the non-phosphorylation site of S776

Ataxin-1 Polyclonal Antibody
ABP50719-01ml	Abbkine	0.1ml	EUR 346.8
Description: A polyclonal antibody for detection of Ataxin-1 from Human, Mouse. This Ataxin-1 antibody is for WB , IHC-P, IF, ELISA. It is affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogenand is unconjugated. The antibody is produced in rabbit by using as an immunogen synthesized peptide derived from human Ataxin-1 around the non-phosphorylation site of S776

Ataxin-1 Polyclonal Antibody
ABP50719-02ml	Abbkine	0.2ml	EUR 496.8
Description: A polyclonal antibody for detection of Ataxin-1 from Human, Mouse. This Ataxin-1 antibody is for WB , IHC-P, IF, ELISA. It is affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogenand is unconjugated. The antibody is produced in rabbit by using as an immunogen synthesized peptide derived from human Ataxin-1 around the non-phosphorylation site of S776

Ataxin-1 Polyclonal Antibody
ES1718-100ul	ELK Biotech	100ul	EUR 334.8
Description: A Rabbit Polyclonal antibody against Ataxin-1 from Human/Mouse. This antibody is tested and validated for WB, ELISA, IHC, IF, WB, ELISA

Ataxin-1 Polyclonal Antibody
ES1718-50ul	ELK Biotech	50ul	EUR 248.4
Description: A Rabbit Polyclonal antibody against Ataxin-1 from Human/Mouse. This antibody is tested and validated for WB, ELISA, IHC, IF, WB, ELISA

Ataxin 1 (ATXN1) Antibody
20-abx242069	Abbexa	EUR 493.20 EUR 360.00	100 ul 50 ul

Ataxin 1 (ATXN1) Antibody
20-abx100304	Abbexa	EUR 477.60 EUR 159.60 EUR 1328.40 EUR 644.40 EUR 376.80	100 ug 10 ug 1 mg 200 ug 50 ug

Ataxin 1 (ATXN1) Antibody
20-abx171342	Abbexa	EUR 944.40 EUR 493.20	1 mg 200 ug

Ataxin 1 (ATXN1) Antibody
20-abx214569	Abbexa	EUR 493.20 EUR 360.00	100 ul 50 ul

Ataxin 1 (ATXN1) Antibody
20-abx133167	Abbexa	EUR 360.00 EUR 526.80 EUR 226.80	100 ul 200 ul 30 ul

Ataxin 1 (pS775) Antibody
20-abx121842	Abbexa	EUR 376.80 EUR 560.40 EUR 243.60	100 ul 200 ul 30 ul

Ataxin 1 (ATXN1) Antibody
20-abx325351	Abbexa	EUR 376.80 EUR 292.80	100 ug 50 ug

Ataxin 1 (ATXN1) Antibody
abx445066-100ug	Abbexa	100 ug	EUR 627.6

Ataxin 1 (ATXN1) Antibody
abx445084-100ug	Abbexa	100 ug	EUR 627.6

Ataxin 1 (ATXN1) Antibody
abx031721-400ul	Abbexa	400 ul	EUR 627.6

Ataxin 1 (ATXN1) Antibody
abx031721-80l	Abbexa	80 µl	EUR 343.2

Ataxin 1 (ATXN1) Antibody
20-abx126836	Abbexa	EUR 493.20 EUR 710.40	100 ul 200 ul

Ataxin 1 (ATXN1) Antibody
20-abx129635	Abbexa	EUR 493.20 EUR 159.60 EUR 1362.00 EUR 661.20 EUR 376.80	100 ug 10 ug 1 mg 200 ug 50 ug

Ataxin 1 (ATXN1) Antibody
20-abx320078	Abbexa	EUR 360.00 EUR 292.80	100 ul 50 ul

Ataxin 1 (ATXN1) Antibody
abx431572-200ul	Abbexa	200 ul	EUR 343.2

Ataxin 1 (ATXN1) Antibody
abx432383-200ul	Abbexa	200 ul	EUR 343.2

Ataxin 1 (ATXN1) Antibody
20-abx004749	Abbexa	EUR 493.20 EUR 710.40 EUR 218.40 EUR 376.80	100 ul 200 ul 20 ul 50 ul

Ataxin 1 (pS776) Antibody
abx010423-100ug	Abbexa	100 ug	EUR 526.8

Ataxin 1 (ATXN1) Antibody
abx010425-100ul	Abbexa	100 ul	EUR 493.2

Ataxin 1 (ATXN1) Antibody
abx145346-100ug	Abbexa	100 ug	EUR 469.2

Ataxin 3 antibody
22437-100ul	SAB	100ul	EUR 468

Ataxin 3 antibody
70R-13630	Fitzgerald	100 ul	EUR 548.4
Description: Affinity purified Rabbit polyclonal Ataxin 3 antibody

Ataxin 10 antibody
70R-50914	Fitzgerald	100 ul	EUR 292.8
Description: Purified Polyclonal Ataxin 10 antibody

Ataxin 2 antibody
70R-50365	Fitzgerald	100 ul	EUR 292.8
Description: Purified Polyclonal Ataxin 2 antibody

Ataxin 3 Antibody
DF6375	Affbiotech	200ul	EUR 420

Ataxin-2 Antibody
R31210	NSJ Bioreagents	100 ug	EUR 356.15
Description: Ataxin-2, the protein encoded by the ATXN2 gene, contains a polyglutamine tract, long expansions (greater than 33 repeats) of which result in spinocerebellar ataxia-2 (SCA2), an autosomal dominant form of olivopontocerebellar atrophy. The gene for spinocerebellar ataxia type 2(SCA2) has been mapped to 12q24.1. Ataxin-2 associates with L- and T-plastin and overexpression leads to accumulation of T-plastin in mammalian cells.

Ataxin 1 (ATXN1) Antibody (RPE)
abx444428-100ug	Abbexa	100 ug	EUR 693.6

Ataxin 1 (ATXN1) Antibody (RPE)
abx444446-100ug	Abbexa	100 ug	EUR 693.6

Ataxin 1 (ATXN1) Antibody (HRP)
abx443585-100ug	Abbexa	100 ug	EUR 678

Ataxin 1 (ATXN1) Antibody (HRP)
abx443603-100ug	Abbexa	100 ug	EUR 678

Ataxin 1 (ATXN1) Antibody (ALP)
abx442463-100ug	Abbexa	100 ug	EUR 693.6

Ataxin 1 (ATXN1) Antibody (ALP)
abx442481-100ug	Abbexa	100 ug	EUR 693.6

Ataxin 1 (ATXN1) Antibody (APC)
abx442744-100ug	Abbexa	100 ug	EUR 693.6

Ataxin 1 (ATXN1) Antibody (APC)
abx442762-100ug	Abbexa	100 ug	EUR 693.6

Ataxin 1 (ATXN1) Antibody (FITC)
abx443304-100ug	Abbexa	100 ug	EUR 678

Ataxin 1 (ATXN1) Antibody (FITC)
abx443322-100ug	Abbexa	100 ug	EUR 678

Ataxin 1 Like (ATXN1L) Antibody
abx030547-400ul	Abbexa	400 ul	EUR 627.6

Ataxin 1 Like (ATXN1L) Antibody
abx030547-80l	Abbexa	80 µl	EUR 343.2

Ataxin 1 (ATXN1) Antibody (PerCP)
abx444147-100ug	Abbexa	100 ug	EUR 693.6

Ataxin 1 (ATXN1) Antibody (PerCP)
abx444165-100ug	Abbexa	100 ug	EUR 693.6

Ataxin 1 Like (ATXN1L) Antibody
20-abx301794	Abbexa	EUR 493.20 EUR 2214.00 EUR 718.80 EUR 218.40 EUR 360.00	100 ug 1 mg 200 ug 20 ug 50 ug

anti- Ataxin 2 antibody
FNab00657	FN Test	100µg	EUR 606.3
Description: Antibody raised against Ataxin 2

Ataxin 1 (ATXN1) Antibody (Biotin)
abx443024-100ug	Abbexa	100 ug	EUR 693.6

Ataxin 1 (ATXN1) Antibody (Biotin)
abx443042-100ug	Abbexa	100 ug	EUR 693.6

Ataxin 3 Antibody / ATXN3
F55027-0.08ML	NSJ Bioreagents	0.08 ml	EUR 140.25
Description: ATXN3 was known as spinocerebellar ataxia-3, is an autosomal dominant neurologic disorder. The protein contains (CAG)n repeats in the coding region, and the expansion of these repeats from the normal 13-36 to 68-79 is one cause of Machado-Joseph disease. There is a negative correlation between the age of onset and CAG repeat numbers.

Ataxin 3 Antibody / ATXN3
F55027-0.4ML	NSJ Bioreagents	0.4 ml	EUR 322.15
Description: ATXN3 was known as spinocerebellar ataxia-3, is an autosomal dominant neurologic disorder. The protein contains (CAG)n repeats in the coding region, and the expansion of these repeats from the normal 13-36 to 68-79 is one cause of Machado-Joseph disease. There is a negative correlation between the age of onset and CAG repeat numbers.

Ataxin 3 Antibody / ATXN3
R32137	NSJ Bioreagents	100 ug	EUR 356.15
Description: ATXN3 (Ataxin 3), also known as AT3, MJD GENE, MJD1, SCA3 GENE, ATX3, JOS, Spinocerebellar ataxia-3, Machado-Joseph disease protein 1, is a protein that in humans is encoded by the ATXN3 gene. ATXN3 ranges in size from 360 to 374 amino acids. Using Northern blot analysis showed that ATXN3 mRNA was ubiquitously expressed in human tissues. They detected at least 4 ATXN3 transcripts of 1.4, 1.8, 4.5, and 7.5 kb and suggested that the different mRNA species probably result from differential splicing and polyadenylation. Machado-Joseph disease, also known as spinocerebellar ataxia-3, is an autosomal dominant neurologic disorder. The protein encoded by the ATXN3 gene contains (CAG)n repeats in the coding region, and the expansion of these repeats from the normal 13-36 to 68-79 is the cause of Machado-Joseph disease. There is an inverse correlation between the age of onset and CAG repeat numbers. Alternatively spliced transcript variants encoding different isoforms have been described for this gene. Ataxin-3 interacted with 2 human homologs of the yeast DNA repair protein RAD23, HHR23A (RAD23A) and HHR23B (RAD23B). Both normal and mutant ataxin-3 proteins interacted with the ubiquitin-like domain at the N terminus of the HHR23 proteins, which is a motif important for nucleotide excision repair. However, in HEK 293 cells, HHR23A was recruited to intranuclear inclusions formed by the mutant ataxin-3 through its interaction with ataxin-3.

Ataxin-1 Polyclonal Conjugated Antibody
C40621	SAB	100ul	EUR 476.4

Phospho- Ataxin 1 (Ser775) Antibody
ABF3347	Lifescience Market	100 ug	EUR 525.6

Monoclonal antibody for Ataxin 1
SMC-455D	Stressmarq	0.1mg	EUR 423.6
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical). . The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is not conjugated.

Monoclonal antibody for Ataxin 1
SMC-455D-A390	Stressmarq	0.1mg	EUR 480
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical). . The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with ATTO 390.

Monoclonal antibody for Ataxin 1
SMC-455D-A488	Stressmarq	0.1mg	EUR 478.8
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical). . The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with ATTO 488.

Monoclonal antibody for Ataxin 1
SMC-455D-A565	Stressmarq	0.1mg	EUR 478.8
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical). . The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with ATTO 565.

Monoclonal antibody for Ataxin 1
SMC-455D-A594	Stressmarq	0.1mg	EUR 478.8
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical). . The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with ATTO 594.

Monoclonal antibody for Ataxin 1
SMC-455D-A633	Stressmarq	0.1mg	EUR 478.8
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical). . The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with ATTO 633.

Monoclonal antibody for Ataxin 1
SMC-455D-A655	Stressmarq	0.1mg	EUR 478.8
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical). . The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with ATTO 655.

Monoclonal antibody for Ataxin 1
SMC-455D-A680	Stressmarq	0.1mg	EUR 478.8
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical). . The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with ATTO 680.

Monoclonal antibody for Ataxin 1
SMC-455D-A700	Stressmarq	0.1mg	EUR 478.8
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical). . The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with ATTO 700.

Monoclonal antibody for Ataxin 1
SMC-455D-ALP	Stressmarq	0.1mg	EUR 471.6
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical). . The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with Alkaline Phosphatase.

Monoclonal antibody for Ataxin 1
SMC-455D-APC	Stressmarq	0.1mg	EUR 477.6
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical). . The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with APC.

Monoclonal antibody for Ataxin 1
SMC-455D-APCCY7	Stressmarq	0.1mg	EUR 564
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical). . The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with APC/Cy7.

Monoclonal antibody for Ataxin 1
SMC-455D-BI	Stressmarq	0.1mg	EUR 474
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical). . The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with Biotin.

Monoclonal antibody for Ataxin 1
SMC-455D-DY350	Stressmarq	0.1mg	EUR 495.6
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical). . The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with Dylight 350.

Monoclonal antibody for Ataxin 1
SMC-455D-DY405	Stressmarq	0.1mg	EUR 482.4
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical). . The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with Dylight 405.

Monoclonal antibody for Ataxin 1
SMC-455D-DY488	Stressmarq	0.1mg	EUR 470.4
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical). . The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with Dylight 488.

Monoclonal antibody for Ataxin 1
SMC-455D-DY594	Stressmarq	0.1mg	EUR 472.8
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical). . The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with Dylight 594.

Monoclonal antibody for Ataxin 1
SMC-455D-DY633	Stressmarq	0.1mg	EUR 466.8
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical). . The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with Dylight 633.

Monoclonal antibody for Ataxin 1
SMC-455D-FITC	Stressmarq	0.1mg	EUR 469.2
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical). . The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with FITC.

Monoclonal antibody for Ataxin 1
SMC-455D-HRP	Stressmarq	0.1mg	EUR 464.4
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical). . The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with HRP.

Monoclonal antibody for Ataxin 1
SMC-455D-P594	Stressmarq	0.1mg	EUR 487.2
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical). . The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with PE/ATTO 594.

Monoclonal antibody for Ataxin 1
SMC-455D-PCP	Stressmarq	0.1mg	EUR 477.6
Description: A monoclonal antibody from clone S76-8 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical). . The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with PerCP.

Monoclonal antibody for Ataxin 1
SMC-455D-RPE	Stressmarq	0.1mg	EUR 475.2
Description: A monoclonal antibody from clone S76-8 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical). . The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with RPE.

Monoclonal antibody for Ataxin 1
SMC-455D-STR	Stressmarq	0.1mg	EUR 476.4
Description: A monoclonal antibody from clone S76-8 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical). . The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with Streptavidin.

Monoclonal antibody for Ataxin 1
SMC-455S	Stressmarq	0.012mg	EUR 78
Description: A monoclonal antibody from clone S76-8 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical). . The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is not conjugated.

Monoclonal antibody for Ataxin 1
SMC-475D	Stressmarq	0.1mg	EUR 423.6
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical). . The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is not conjugated.

Monoclonal antibody for Ataxin 1
SMC-475D-A390	Stressmarq	0.1mg	EUR 480
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical). . The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with ATTO 390.

Monoclonal antibody for Ataxin 1
SMC-475D-A488	Stressmarq	0.1mg	EUR 478.8
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical). . The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with ATTO 488.

Monoclonal antibody for Ataxin 1
SMC-475D-A565	Stressmarq	0.1mg	EUR 478.8
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical). . The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with ATTO 565.

Monoclonal antibody for Ataxin 1
SMC-475D-A594	Stressmarq	0.1mg	EUR 478.8
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical). . The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with ATTO 594.

Monoclonal antibody for Ataxin 1
SMC-475D-A633	Stressmarq	0.1mg	EUR 478.8
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical). . The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with ATTO 633.

Monoclonal antibody for Ataxin 1
SMC-475D-A655	Stressmarq	0.1mg	EUR 478.8
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical). . The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with ATTO 655.

Monoclonal antibody for Ataxin 1
SMC-475D-A680	Stressmarq	0.1mg	EUR 478.8
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical). . The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with ATTO 680.

Monoclonal antibody for Ataxin 1
SMC-475D-A700	Stressmarq	0.1mg	EUR 478.8
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical). . The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with ATTO 700.

Monoclonal antibody for Ataxin 1
SMC-475D-ALP	Stressmarq	0.1mg	EUR 471.6
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical). . The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with Alkaline Phosphatase.

Monoclonal antibody for Ataxin 1
SMC-475D-APC	Stressmarq	0.1mg	EUR 477.6
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical). . The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with APC.

Monoclonal antibody for Ataxin 1
SMC-475D-APCCY7	Stressmarq	0.1mg	EUR 564
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical). . The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with APC/Cy7.

Monoclonal antibody for Ataxin 1
SMC-475D-BI	Stressmarq	0.1mg	EUR 474
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical). . The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with Biotin.

Monoclonal antibody for Ataxin 1
SMC-475D-DY350	Stressmarq	0.1mg	EUR 495.6
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical). . The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with Dylight 350.

Monoclonal antibody for Ataxin 1
SMC-475D-DY405	Stressmarq	0.1mg	EUR 482.4
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical). . The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with Dylight 405.

Monoclonal antibody for Ataxin 1
SMC-475D-DY488	Stressmarq	0.1mg	EUR 470.4
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical). . The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with Dylight 488.

Monoclonal antibody for Ataxin 1
SMC-475D-DY594	Stressmarq	0.1mg	EUR 472.8
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical). . The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with Dylight 594.

Monoclonal antibody for Ataxin 1
SMC-475D-DY633	Stressmarq	0.1mg	EUR 466.8
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical). . The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with Dylight 633.

Monoclonal antibody for Ataxin 1
SMC-475D-FITC	Stressmarq	0.1mg	EUR 469.2
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical). . The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with FITC.

Monoclonal antibody for Ataxin 1
SMC-475D-HRP	Stressmarq	0.1mg	EUR 464.4
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical). . The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with HRP.

Monoclonal antibody for Ataxin 1
SMC-475D-P594	Stressmarq	0.1mg	EUR 487.2
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical). . The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with PE/ATTO 594.

Monoclonal antibody for Ataxin 1
SMC-475D-PCP	Stressmarq	0.1mg	EUR 477.6
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical). . The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with PerCP.

Monoclonal antibody for Ataxin 1
SMC-475D-RPE	Stressmarq	0.1mg	EUR 475.2
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical). . The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with RPE.

Monoclonal antibody for Ataxin 1
SMC-475D-STR	Stressmarq	0.1mg	EUR 476.4
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical). . The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with Streptavidin.

Monoclonal antibody for Ataxin 1
SMC-475S	Stressmarq	0.012mg	EUR 78
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical). . The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is not conjugated.

Ataxin-2 Antibody / ATXN2
R32313	NSJ Bioreagents	100 ug	EUR 356.15
Description: Ataxin-2, or ATX2, protein is encoded by the ATXN2 gene and contains a polyglutamine tract, long expansions (greater than 33 repeats) of which result in spinocerebellar ataxia-2 (SCA2), an autosomal dominant form of olivopontocerebellar atrophy. The gene for spinocerebellar ataxia type 2 (SCA2) has been mapped to 12q24.1. Ataxin-2 associates with L- and T-plastin and that overexpression of ataxin-2 leads to accumulation of T-plastin in mammalian cells.

Ataxin 1 (Phospho-Ser776) Antibody
12034-100ul	SAB	100ul	EUR 302.4

Ataxin 1 (Phospho-Ser776) Antibody
12034-50ul	SAB	50ul	EUR 224.4

Ataxin 1 (ATXN1) Polyclonal Antibody (Human, Mouse, Rat)
4-PAA514Hu01	Cloud-Clone	EUR 278.40 EUR 2742.00 EUR 688.80 EUR 346.80 EUR 249.60	100ul 10ml 1ml 200ul 20ul
Description: A Rabbit polyclonal antibody against Human, Mouse, Rat Ataxin 1 (ATXN1)

Polyclonal Ataxin 10 Antibody
APG03169G	Leading Biology	0.1ml	EUR 580.8
Description: A polyclonal antibody raised in Rabbit that recognizes and binds to Human Ataxin 10 . This antibody is tested and proven to work in the following applications:

Polyclonal Ataxin 2 Antibody
APG03170G	Leading Biology	0.1ml	EUR 580.8
Description: A polyclonal antibody raised in Rabbit that recognizes and binds to Human Ataxin 2 . This antibody is tested and proven to work in the following applications:

Ataxin 1 (ATXN1) Antibody (Streptavidin)
abx444709-100ug	Abbexa	100 ug	EUR 693.6

Ataxin 1 (ATXN1) Antibody (Streptavidin)
abx444727-100ug	Abbexa	100 ug	EUR 693.6

Ataxin-3 (pS256) Antibody
abx148457-100ug	Abbexa	100 ug	EUR 526.8

Ataxin 1 (ATXN1) Antibody (ATTO 390)
abx440215-100ug	Abbexa	100 ug	EUR 693.6

Ataxin 1 (ATXN1) Antibody (ATTO 390)
abx440233-100ug	Abbexa	100 ug	EUR 693.6

Ataxin 1 (ATXN1) Antibody (ATTO 488)
abx440496-100ug	Abbexa	100 ug	EUR 693.6

Ataxin 1 (ATXN1) Antibody (ATTO 488)
abx440514-100ug	Abbexa	100 ug	EUR 693.6

Ataxin 1 (ATXN1) Antibody (ATTO 565)
abx440777-100ug	Abbexa	100 ug	EUR 693.6

Ataxin 1 (ATXN1) Antibody (ATTO 565)
abx440795-100ug	Abbexa	100 ug	EUR 693.6

Ataxin 1 (ATXN1) Antibody (ATTO 594)
abx441058-100ug	Abbexa	100 ug	EUR 693.6

Ataxin 1 (ATXN1) Antibody (ATTO 594)
abx441076-100ug	Abbexa	100 ug	EUR 693.6

Ataxin 1 (ATXN1) Antibody (ATTO 633)
abx441339-100ug	Abbexa	100 ug	EUR 693.6

Ataxin 1 (ATXN1) Antibody (ATTO 633)
abx441357-100ug	Abbexa	100 ug	EUR 693.6

Ataxin 1 (ATXN1) Antibody (ATTO 655)
abx441620-100ug	Abbexa	100 ug	EUR 693.6

Ataxin 1 (ATXN1) Antibody (ATTO 655)
abx441638-100ug	Abbexa	100 ug	EUR 693.6

Ataxin 1 (ATXN1) Antibody (ATTO 680)
abx441901-100ug	Abbexa	100 ug	EUR 693.6

Ataxin 1 (ATXN1) Antibody (ATTO 680)
abx441919-100ug	Abbexa	100 ug	EUR 693.6

Ataxin 1 (ATXN1) Antibody (ATTO 700)
abx442182-100ug	Abbexa	100 ug	EUR 693.6

Ataxin 1 (ATXN1) Antibody (ATTO 700)
abx442200-100ug	Abbexa	100 ug	EUR 693.6

Ataxin 1 Like (ATXN1L) Antibody (HRP)
20-abx314758	Abbexa	EUR 493.20 EUR 2214.00 EUR 718.80 EUR 218.40 EUR 360.00	100 ug 1 mg 200 ug 20 ug 50 ug

Ataxin 7 Like 1 (ATXN7L1) Antibody
20-abx325156	Abbexa	EUR 376.80 EUR 292.80	100 ug 50 ug

Ataxin 1 Like (ATXN1L) Antibody (FITC)
20-abx314759	Abbexa	EUR 493.20 EUR 2214.00 EUR 718.80 EUR 218.40 EUR 360.00	100 ug 1 mg 200 ug 20 ug 50 ug

Ataxin 1 (ATXN1) Polyclonal Antibody (Human, Mouse, Rat), PE
4-PAA514Hu01-PE	Cloud-Clone	EUR 334.80 EUR 2874.00 EUR 825.60 EUR 416.40 EUR 225.60	100ul 10ml 1ml 200ul 20ul
Description: A Rabbit polyclonal antibody against Human, Mouse, Rat Ataxin 1 (ATXN1). This antibody is labeled with PE.

Ataxin-2 Polyclonal Antibody
40622-100ul	SAB	100ul	EUR 302.4

Ataxin-2 Polyclonal Antibody
40622-50ul	SAB	50ul	EUR 224.4

Ataxin-2 Polyclonal Antibody
ABP50720-003ml	Abbkine	0.03ml	EUR 189.6
Description: A polyclonal antibody for detection of Ataxin-2 from Human. This Ataxin-2 antibody is for WB , IHC-P, ELISA. It is affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogenand is unconjugated. The antibody is produced in rabbit by using as an immunogen synthesized peptide derived from the Internal region of human Ataxin-2 at AA range: 700-780

Ataxin-2 Polyclonal Antibody
ABP50720-01ml	Abbkine	0.1ml	EUR 346.8
Description: A polyclonal antibody for detection of Ataxin-2 from Human. This Ataxin-2 antibody is for WB , IHC-P, ELISA. It is affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogenand is unconjugated. The antibody is produced in rabbit by using as an immunogen synthesized peptide derived from the Internal region of human Ataxin-2 at AA range: 700-780

Ataxin-2 Polyclonal Antibody
ABP50720-02ml	Abbkine	0.2ml	EUR 496.8
Description: A polyclonal antibody for detection of Ataxin-2 from Human. This Ataxin-2 antibody is for WB , IHC-P, ELISA. It is affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogenand is unconjugated. The antibody is produced in rabbit by using as an immunogen synthesized peptide derived from the Internal region of human Ataxin-2 at AA range: 700-780

Ataxin-2 Polyclonal Antibody
ES1719-100ul	ELK Biotech	100ul	EUR 334.8
Description: A Rabbit Polyclonal antibody against Ataxin-2 from Human. This antibody is tested and validated for WB, ELISA, IHC, WB, ELISA

Ataxin-2 Polyclonal Antibody
ES1719-50ul	ELK Biotech	50ul	EUR 248.4
Description: A Rabbit Polyclonal antibody against Ataxin-2 from Human. This antibody is tested and validated for WB, ELISA, IHC, WB, ELISA

Ataxin-1 (phospho Ser776) Polyclonal Antibody
ABP56120-003ml	Abbkine	0.03ml	EUR 189.6
Description: A polyclonal antibody for detection of Ataxin-1 phospho Ser776) from Human, Mouse. This Ataxin-1 phospho Ser776) antibody is for WB, IHC-P, IF, ELISA. It is affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogenand is unconjugated. The antibody is produced in rabbit by using as an immunogen synthesized peptide derived from human Ataxin-1 around the phosphorylation site of S776

Ataxin-1 (phospho Ser776) Polyclonal Antibody
ABP56120-01ml	Abbkine	0.1ml	EUR 346.8
Description: A polyclonal antibody for detection of Ataxin-1 phospho Ser776) from Human, Mouse. This Ataxin-1 phospho Ser776) antibody is for WB, IHC-P, IF, ELISA. It is affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogenand is unconjugated. The antibody is produced in rabbit by using as an immunogen synthesized peptide derived from human Ataxin-1 around the phosphorylation site of S776

These outcomes counsel that ATXN2 is concerned within the pathological strategy of FTLD-TDP. It stays to be clarified whether or not decreased ATXN2 expression induces neurodegeneration by impairing protein synthesis or performs a neuroprotective function by attenuating the toxicity of TDP-43 aggregates in FTLD-TDP and different TDP-43 proteinopathies.