Background: Aberrations in Capicua (CIC) have lately been implicated as a adverse prognostic consider a mess of most cancers sorts by means of the derepression of targets downstream of the mitogen-activated protein kinase (MAPK) signaling cascade, similar to oncogenic E26 transformation-specific (ETS) transcription components. The Ataxin-family protein ATXN1L has beforehand been reported to work together with CIC in each developmental and illness contexts to facilitate the repression of CIC goal genes and promote the post-translational stability of CIC. Nevertheless, little is understood concerning the mechanisms on the base of ATXN1L-mediated CIC post-translational stability.
Outcomes: Useful in vitro research using ATXN1L human cell traces revealed that lack of ATXN1L results in the buildup of polyubiquitinated CIC protein, selling its degradation by means of the proteasome. Though transcriptomic signatures of ATXN1LKO cell traces indicated upregulation of the mitogen-activated protein kinase pathway, ERK exercise was discovered to contribute to CIC operate however not stability. Degradation of CIC protein following lack of ATXN1L was as an alternative noticed to be mediated by the E3 ubiquitin ligase TRIM25 which was additional validated utilizing glioma-derived cell traces and the TCGA breast carcinoma and liver hepatocellular carcinoma cohorts.
Conclusions: The post-translational regulation of CIC by means of ATXN1L and TRIM25 unbiased of ERK exercise means that the regulation of CIC stability and performance is extra intricate than beforehand appreciated and includes a number of unbiased pathways. As CIC standing has develop into a prognostic consider a number of most cancers sorts, additional data into the mechanisms which govern CIC stability and performance could show helpful for future therapeutic approaches.
Ataxin-2 Dysregulation Triggers a Compensatory Fragile X Psychological Retardation Protein Lower in Drosophila C4da Neurons
Dendrites require exact and well timed supply of protein substrates to distal areas to make sure the proper morphology and performance of neurons. Many of those protein substrates are equipped within the type of ribonucleoprotein (RNP) complicated consisting of RNA-binding proteins (RBPs) and mRNAs, that are subsequently translated in distal dendritic areas. It stays elusive, nonetheless, whether or not key RBPs provide mRNA in line with native calls for individually or in a coordinated method.
On this examine, we investigated how Drosophila sensory neurons reply to the dysregulation of a disease-associated RBP, Ataxin-2 (ATX2), which ends up in dendritic defects. We discovered that ATX2 performs an important function in spacing dendritic branches for the optimum dendritic receptive fields in Drosophila class IV dendritic arborization (C4da) neurons, the place each expression degree and subcellular location of ATX2 contribute considerably to this impact. We confirmed that translational upregulation by means of the expression of eukaryotic translation initiation issue 4E (eIF4E) additional enhanced the ATX2-induced dendritic phenotypes. Moreover, we discovered that the expression degree of one other disease-associated RBP, fragile X psychological retardation protein (FMRP), decreased in each cell our bodies and dendrites when neurons had been confronted with aberrant upregulation of ATX2. Lastly, we revealed that the PAM2 motif of ATX2, which mediates its interplay with poly(A)-binding protein (PABP), is probably mandatory for the lower of FMRP in sure neuronal stress situations.
Collectively, our knowledge counsel that dysregulation of RBPs triggers a compensatory regulation of different functionally-overlapping RBPs to reduce RBP dysregulation-associated aberrations that hinder neuronal homeostasis in dendrites. Lignin-carbohydrate complicated (LCC) is the organic macromolecule that has been demonstrated to exert a number of organic capabilities, together with antioxidant, anti-inflammation and anti-tumorigenesis, which help its broad utility within the bioengineering discipline. Nevertheless, it stays elusive the involvements of LCC in human neurological issues, particularly these with the overproduction of reactive oxygen species (ROS), similar to spinocerebellar ataxias (SCAs). On this examine, we discovered a beforehand undetermined anti-protein aggregation exercise of LCC.

TRIM25 promotes Capicua degradation independently of ERK in the absence of ATXN1L
Intracellular dynamics of Ataxin-2 within the human brains with regular and frontotemporal lobar degeneration with TDP-43 inclusions
TAR DNA-binding protein of 43 kDa (TDP-43) is a serious element of intracellular aggregates fashioned in brains of the sufferers with frontotemporal lobar degeneration (FTLD) and amyotrophic lateral sclerosis (ALS), that are correctively known as TDP-43 proteinopathies. A hyperlink between Ataxin-2 (ATXN2) and TDP-43 proteinopathies was established when intermediate CAG repeat expansions of ATXN2 gene had been discovered to be related to ALS and it was proven that ATXN2 modifies TDP-43 toxicity. Though ATXN2’s contribution to TDP-43 proteinopathies has been largely studied in ALS, current research have proven that intermediate repeat expansions of ATXN2 additionally affect the phenotype of FTLD by an unknown mechanism. To handle this difficulty, we immunohistochemically and biochemically analyzed the intracellular dynamics of ATXN2 in brains of regular controls and FTLD-TDP circumstances.
The immunohistochemical research revealed that ATXN2 localized within the neuronal cytoplasm and proximal dendrites, and expressed broadly and uniformly in regular human brains. A semi-quantitative immunofluorescent evaluation of regular brains revealed that the cytoplasmic ATXN2 strongly associates with ribosomal protein S6 and poly-A binding protein 1 and partially overlaps with the endoplasmic reticulum marker Calnexin, suggesting a serious function of ATXN2 in protein synthesis. The outcomes of immunohistochemical and biochemical analyses of brains from FTLD-TDP circumstances confirmed the colocalization of ATXN2 and phosphorylated TDP-43 within the dystrophic neurites and the neuronal cytoplasmic inclusions within the hippocampal area, and a major discount of ATXN2 protein in comparison with controls.
Ataxin 1 (ATXN1) Antibody |
|||
20-abx171342 | Abbexa |
|
|
Ataxin 1 (ATXN1) Antibody |
|||
20-abx133167 | Abbexa |
|
|
Ataxin 1 (ATXN1) Antibody |
|||
abx145346-100ug | Abbexa | 100 ug | EUR 469.2 |
Ataxin-1 Polyclonal Antibody |
|||
ABP50719-003ml | Abbkine | 0.03ml | EUR 189.6 |
Description: A polyclonal antibody for detection of Ataxin-1 from Human, Mouse. This Ataxin-1 antibody is for WB , IHC-P, IF, ELISA. It is affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogenand is unconjugated. The antibody is produced in rabbit by using as an immunogen synthesized peptide derived from human Ataxin-1 around the non-phosphorylation site of S776 |
Ataxin-1 Polyclonal Antibody |
|||
ABP50719-01ml | Abbkine | 0.1ml | EUR 346.8 |
Description: A polyclonal antibody for detection of Ataxin-1 from Human, Mouse. This Ataxin-1 antibody is for WB , IHC-P, IF, ELISA. It is affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogenand is unconjugated. The antibody is produced in rabbit by using as an immunogen synthesized peptide derived from human Ataxin-1 around the non-phosphorylation site of S776 |
Ataxin-1 Polyclonal Antibody |
|||
ABP50719-02ml | Abbkine | 0.2ml | EUR 496.8 |
Description: A polyclonal antibody for detection of Ataxin-1 from Human, Mouse. This Ataxin-1 antibody is for WB , IHC-P, IF, ELISA. It is affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogenand is unconjugated. The antibody is produced in rabbit by using as an immunogen synthesized peptide derived from human Ataxin-1 around the non-phosphorylation site of S776 |
Ataxin 1 (ATXN1) Antibody |
|||
20-abx100304 | Abbexa |
|
|
Ataxin 1 (ATXN1) Antibody |
|||
20-abx004749 | Abbexa |
|
|
Ataxin 1 (pS775) Antibody |
|||
20-abx121842 | Abbexa |
|
|
Ataxin 1 (ATXN1) Antibody |
|||
20-abx126836 | Abbexa |
|
|
Ataxin 1 (ATXN1) Antibody |
|||
20-abx129635 | Abbexa |
|
|
Ataxin 1 (pS776) Antibody |
|||
abx010423-100ug | Abbexa | 100 ug | EUR 526.8 |
Ataxin 1 (ATXN1) Antibody |
|||
abx010425-100ul | Abbexa | 100 ul | EUR 493.2 |
Ataxin 1 (ATXN1) Antibody |
|||
abx031721-400ul | Abbexa | 400 ul | EUR 627.6 |
Ataxin 1 (ATXN1) Antibody |
|||
abx031721-80l | Abbexa | 80 µl | EUR 343.2 |
Ataxin 1 (ATXN1) Antibody |
|||
20-abx320078 | Abbexa |
|
|
Ataxin 1 (ATXN1) Antibody |
|||
20-abx242069 | Abbexa |
|
|
Ataxin 1 (ATXN1) Antibody |
|||
20-abx325351 | Abbexa |
|
|
Ataxin 1 (ATXN1) Antibody |
|||
abx431572-200ul | Abbexa | 200 ul | EUR 343.2 |
Ataxin 1 (ATXN1) Antibody |
|||
abx432383-200ul | Abbexa | 200 ul | EUR 343.2 |
Ataxin 1 (ATXN1) Antibody |
|||
abx445066-100ug | Abbexa | 100 ug | EUR 627.6 |
Ataxin 1 (ATXN1) Antibody |
|||
abx445084-100ug | Abbexa | 100 ug | EUR 627.6 |
Ataxin 1 (ATXN1) Antibody |
|||
20-abx214569 | Abbexa |
|
|
Ataxin-1 Polyclonal Antibody |
|||
ES1718-100ul | ELK Biotech | 100ul | EUR 334.8 |
Description: A Rabbit Polyclonal antibody against Ataxin-1 from Human/Mouse. This antibody is tested and validated for WB, ELISA, IHC, IF, WB, ELISA |
Ataxin-1 Polyclonal Antibody |
|||
ES1718-50ul | ELK Biotech | 50ul | EUR 248.4 |
Description: A Rabbit Polyclonal antibody against Ataxin-1 from Human/Mouse. This antibody is tested and validated for WB, ELISA, IHC, IF, WB, ELISA |
Anti-Ataxin-1 antibody |
|||
STJ91738 | St John's Laboratory | 200 µl | EUR 236.4 |
Description: Rabbit polyclonal to Ataxin-1. |
Anti-Ataxin-1 antibody |
|||
STJ97853 | St John's Laboratory | 100 µl | EUR 280.8 |
Description: Mouse monoclonal to Ataxin-1. |
Ataxin 1 Antibody / ATXN1 |
|||
R32138 | NSJ Bioreagents | 100 ug | EUR 419 |
Ataxin 1 (Phospho-Ser776) Antibody |
|||
12034-100ul | SAB | 100ul | EUR 302.4 |
Ataxin 1 (Phospho-Ser776) Antibody |
|||
12034-50ul | SAB | 50ul | EUR 224.4 |
Ataxin 1 Like (ATXN1L) Antibody |
|||
abx030547-400ul | Abbexa | 400 ul | EUR 627.6 |
Ataxin 1 Like (ATXN1L) Antibody |
|||
abx030547-80l | Abbexa | 80 µl | EUR 343.2 |
Phospho- Ataxin 1 (Ser775) Antibody |
|||
ABF3347 | Lifescience Market | 100 ug | EUR 525.6 |
Ataxin 1 Like (ATXN1L) Antibody |
|||
20-abx301794 | Abbexa |
|
|
Ataxin 1 (ATXN1) Antibody (ALP) |
|||
abx442463-100ug | Abbexa | 100 ug | EUR 693.6 |
Ataxin 1 (ATXN1) Antibody (ALP) |
|||
abx442481-100ug | Abbexa | 100 ug | EUR 693.6 |
Ataxin 1 (ATXN1) Antibody (APC) |
|||
abx442744-100ug | Abbexa | 100 ug | EUR 693.6 |
Ataxin 1 (ATXN1) Antibody (APC) |
|||
abx442762-100ug | Abbexa | 100 ug | EUR 693.6 |
Ataxin 1 (ATXN1) Antibody (Biotin) |
|||
abx443024-100ug | Abbexa | 100 ug | EUR 693.6 |
Ataxin 1 (ATXN1) Antibody (Biotin) |
|||
abx443042-100ug | Abbexa | 100 ug | EUR 693.6 |
Ataxin 1 (ATXN1) Antibody (FITC) |
|||
abx443304-100ug | Abbexa | 100 ug | EUR 678 |
Ataxin 1 (ATXN1) Antibody (FITC) |
|||
abx443322-100ug | Abbexa | 100 ug | EUR 678 |
Ataxin 1 (ATXN1) Antibody (HRP) |
|||
abx443585-100ug | Abbexa | 100 ug | EUR 678 |
Ataxin 1 (ATXN1) Antibody (HRP) |
|||
abx443603-100ug | Abbexa | 100 ug | EUR 678 |
Ataxin 1 (ATXN1) Antibody (PerCP) |
|||
abx444147-100ug | Abbexa | 100 ug | EUR 693.6 |
Ataxin 1 (ATXN1) Antibody (PerCP) |
|||
abx444165-100ug | Abbexa | 100 ug | EUR 693.6 |
Ataxin 1 (ATXN1) Antibody (RPE) |
|||
abx444428-100ug | Abbexa | 100 ug | EUR 693.6 |
Ataxin 1 (ATXN1) Antibody (RPE) |
|||
abx444446-100ug | Abbexa | 100 ug | EUR 693.6 |
Ataxin 1 (ATXN1) Antibody (Streptavidin) |
|||
abx444709-100ug | Abbexa | 100 ug | EUR 693.6 |
Ataxin 1 (ATXN1) Antibody (Streptavidin) |
|||
abx444727-100ug | Abbexa | 100 ug | EUR 693.6 |
Phospho-Ataxin 1 (Ser775) Antibody |
|||
AF3347 | Affbiotech | 200ul | EUR 420 |
Ataxin-1 Polyclonal Conjugated Antibody |
|||
C40621 | SAB | 100ul | EUR 476.4 |
Anti-Ataxin 1/ATXN1 Antibody |
|||
PA2097 | BosterBio | 100ug/vial | EUR 352.8 |
Anti-Ataxin 1/ATXN1 Antibody |
|||
PB9422 | BosterBio | 100ug/vial | EUR 400.8 |
Monoclonal antibody for Ataxin 1 |
|||
SMC-455D | Stressmarq | 0.1mg | EUR 423.6 |
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical).
. The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is not conjugated. |
Monoclonal antibody for Ataxin 1 |
|||
SMC-455D-A390 | Stressmarq | 0.1mg | EUR 480 |
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical).
. The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with ATTO 390. |
Monoclonal antibody for Ataxin 1 |
|||
SMC-455D-A488 | Stressmarq | 0.1mg | EUR 478.8 |
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical).
. The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with ATTO 488. |
Monoclonal antibody for Ataxin 1 |
|||
SMC-455D-A565 | Stressmarq | 0.1mg | EUR 478.8 |
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical).
. The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with ATTO 565. |
Monoclonal antibody for Ataxin 1 |
|||
SMC-455D-A594 | Stressmarq | 0.1mg | EUR 478.8 |
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical).
. The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with ATTO 594. |
Monoclonal antibody for Ataxin 1 |
|||
SMC-455D-A633 | Stressmarq | 0.1mg | EUR 478.8 |
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical).
. The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with ATTO 633. |
Monoclonal antibody for Ataxin 1 |
|||
SMC-455D-A655 | Stressmarq | 0.1mg | EUR 478.8 |
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical).
. The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with ATTO 655. |
Monoclonal antibody for Ataxin 1 |
|||
SMC-455D-A680 | Stressmarq | 0.1mg | EUR 478.8 |
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical).
. The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with ATTO 680. |
Monoclonal antibody for Ataxin 1 |
|||
SMC-455D-A700 | Stressmarq | 0.1mg | EUR 478.8 |
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical).
. The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with ATTO 700. |
Monoclonal antibody for Ataxin 1 |
|||
SMC-455D-ALP | Stressmarq | 0.1mg | EUR 471.6 |
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical).
. The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with Alkaline Phosphatase. |
Monoclonal antibody for Ataxin 1 |
|||
SMC-455D-APC | Stressmarq | 0.1mg | EUR 477.6 |
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical).
. The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with APC. |
Monoclonal antibody for Ataxin 1 |
|||
SMC-455D-APCCY7 | Stressmarq | 0.1mg | EUR 564 |
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical).
. The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with APC/Cy7. |
Monoclonal antibody for Ataxin 1 |
|||
SMC-455D-BI | Stressmarq | 0.1mg | EUR 474 |
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical).
. The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with Biotin. |
Monoclonal antibody for Ataxin 1 |
|||
SMC-455D-DY350 | Stressmarq | 0.1mg | EUR 495.6 |
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical).
. The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with Dylight 350. |
Monoclonal antibody for Ataxin 1 |
|||
SMC-455D-DY405 | Stressmarq | 0.1mg | EUR 482.4 |
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical).
. The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with Dylight 405. |
Monoclonal antibody for Ataxin 1 |
|||
SMC-455D-DY488 | Stressmarq | 0.1mg | EUR 470.4 |
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical).
. The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with Dylight 488. |
Monoclonal antibody for Ataxin 1 |
|||
SMC-455D-DY594 | Stressmarq | 0.1mg | EUR 472.8 |
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical).
. The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with Dylight 594. |
Monoclonal antibody for Ataxin 1 |
|||
SMC-455D-DY633 | Stressmarq | 0.1mg | EUR 466.8 |
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical).
. The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with Dylight 633. |
Monoclonal antibody for Ataxin 1 |
|||
SMC-455D-FITC | Stressmarq | 0.1mg | EUR 469.2 |
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical).
. The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with FITC. |
Monoclonal antibody for Ataxin 1 |
|||
SMC-455D-HRP | Stressmarq | 0.1mg | EUR 464.4 |
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical).
. The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with HRP. |
Monoclonal antibody for Ataxin 1 |
|||
SMC-455D-P594 | Stressmarq | 0.1mg | EUR 487.2 |
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical).
. The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with PE/ATTO 594. |
Monoclonal antibody for Ataxin 1 |
|||
SMC-455D-PCP | Stressmarq | 0.1mg | EUR 477.6 |
Description: A monoclonal antibody from clone S76-8 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical).
. The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with PerCP. |
Monoclonal antibody for Ataxin 1 |
|||
SMC-455D-RPE | Stressmarq | 0.1mg | EUR 475.2 |
Description: A monoclonal antibody from clone S76-8 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical).
. The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with RPE. |
Monoclonal antibody for Ataxin 1 |
|||
SMC-455D-STR | Stressmarq | 0.1mg | EUR 476.4 |
Description: A monoclonal antibody from clone S76-8 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical).
. The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with Streptavidin. |
Monoclonal antibody for Ataxin 1 |
|||
SMC-455S | Stressmarq | 0.012mg | EUR 78 |
Description: A monoclonal antibody from clone S76-8 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical).
. The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is not conjugated. |
Monoclonal antibody for Ataxin 1 |
|||
SMC-475D | Stressmarq | 0.1mg | EUR 423.6 |
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical).
. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is not conjugated. |
Monoclonal antibody for Ataxin 1 |
|||
SMC-475D-A390 | Stressmarq | 0.1mg | EUR 480 |
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical).
. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with ATTO 390. |
Monoclonal antibody for Ataxin 1 |
|||
SMC-475D-A488 | Stressmarq | 0.1mg | EUR 478.8 |
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical).
. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with ATTO 488. |
Monoclonal antibody for Ataxin 1 |
|||
SMC-475D-A565 | Stressmarq | 0.1mg | EUR 478.8 |
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical).
. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with ATTO 565. |
Monoclonal antibody for Ataxin 1 |
|||
SMC-475D-A594 | Stressmarq | 0.1mg | EUR 478.8 |
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical).
. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with ATTO 594. |
Monoclonal antibody for Ataxin 1 |
|||
SMC-475D-A633 | Stressmarq | 0.1mg | EUR 478.8 |
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical).
. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with ATTO 633. |
Monoclonal antibody for Ataxin 1 |
|||
SMC-475D-A655 | Stressmarq | 0.1mg | EUR 478.8 |
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical).
. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with ATTO 655. |
Monoclonal antibody for Ataxin 1 |
|||
SMC-475D-A680 | Stressmarq | 0.1mg | EUR 478.8 |
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical).
. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with ATTO 680. |
Monoclonal antibody for Ataxin 1 |
|||
SMC-475D-A700 | Stressmarq | 0.1mg | EUR 478.8 |
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical).
. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with ATTO 700. |
Monoclonal antibody for Ataxin 1 |
|||
SMC-475D-ALP | Stressmarq | 0.1mg | EUR 471.6 |
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical).
. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with Alkaline Phosphatase. |
Monoclonal antibody for Ataxin 1 |
|||
SMC-475D-APC | Stressmarq | 0.1mg | EUR 477.6 |
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical).
. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with APC. |
Monoclonal antibody for Ataxin 1 |
|||
SMC-475D-APCCY7 | Stressmarq | 0.1mg | EUR 564 |
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical).
. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with APC/Cy7. |
Monoclonal antibody for Ataxin 1 |
|||
SMC-475D-BI | Stressmarq | 0.1mg | EUR 474 |
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical).
. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with Biotin. |
Monoclonal antibody for Ataxin 1 |
|||
SMC-475D-DY350 | Stressmarq | 0.1mg | EUR 495.6 |
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical).
. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with Dylight 350. |
Monoclonal antibody for Ataxin 1 |
|||
SMC-475D-DY405 | Stressmarq | 0.1mg | EUR 482.4 |
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical).
. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with Dylight 405. |
Monoclonal antibody for Ataxin 1 |
|||
SMC-475D-DY488 | Stressmarq | 0.1mg | EUR 470.4 |
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical).
. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with Dylight 488. |
Monoclonal antibody for Ataxin 1 |
|||
SMC-475D-DY594 | Stressmarq | 0.1mg | EUR 472.8 |
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical).
. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with Dylight 594. |
Monoclonal antibody for Ataxin 1 |
|||
SMC-475D-DY633 | Stressmarq | 0.1mg | EUR 466.8 |
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical).
. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with Dylight 633. |
Monoclonal antibody for Ataxin 1 |
|||
SMC-475D-FITC | Stressmarq | 0.1mg | EUR 469.2 |
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical).
. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with FITC. |
Monoclonal antibody for Ataxin 1 |
|||
SMC-475D-HRP | Stressmarq | 0.1mg | EUR 464.4 |
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical).
. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with HRP. |
Monoclonal antibody for Ataxin 1 |
|||
SMC-475D-P594 | Stressmarq | 0.1mg | EUR 487.2 |
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical).
. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with PE/ATTO 594. |
Monoclonal antibody for Ataxin 1 |
|||
SMC-475D-PCP | Stressmarq | 0.1mg | EUR 477.6 |
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical).
. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with PerCP. |
Monoclonal antibody for Ataxin 1 |
|||
SMC-475D-RPE | Stressmarq | 0.1mg | EUR 475.2 |
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical).
. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with RPE. |
Monoclonal antibody for Ataxin 1 |
|||
SMC-475D-STR | Stressmarq | 0.1mg | EUR 476.4 |
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical).
. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with Streptavidin. |
Monoclonal antibody for Ataxin 1 |
|||
SMC-475S | Stressmarq | 0.012mg | EUR 78 |
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical).
. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is not conjugated. |
Human Ataxin 1 (ATXN1) Protein |
|||
20-abx065471 | Abbexa |
|
|
Human Ataxin 1 ELISA kit |
|||
E01A0540-192T | BlueGene | 192 tests | EUR 1524 |
Description: A competitive ELISA for quantitative measurement of Human Ataxin 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Human Ataxin 1 ELISA kit |
|||
E01A0540-48 | BlueGene | 1 plate of 48 wells | EUR 624 |
Description: A competitive ELISA for quantitative measurement of Human Ataxin 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Human Ataxin 1 ELISA kit |
|||
E01A0540-96 | BlueGene | 1 plate of 96 wells | EUR 822 |
Description: A competitive ELISA for quantitative measurement of Human Ataxin 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Human Genomic DNA |
|||
X11000 | EpiGentek |
|
|
Human Brain Genomic DNA |
|||
X11001 | EpiGentek |
|
|
Histone H3K4 Methylation Antibody Panel Pack |
|||
C10005 | EpiGentek |
|
|
Histone H3K9 Methylation Antibody Panel Pack |
|||
C10006 | EpiGentek |
|
|
Histone H3K27 Methylation Antibody Panel Pack |
|||
C10007 | EpiGentek |
|
|
Histone H3K36 Methylation Antibody Panel Pack |
|||
C10008 | EpiGentek |
|
|
Histone H3K79 Methylation Antibody Panel Pack |
|||
C10009 | EpiGentek |
|
|
Histone H4K20 Methylation Antibody Panel Pack |
|||
C10012 | EpiGentek |
|
|
Histone H4 Acetylation Antibody Panel Pack |
|||
C10013 | EpiGentek |
|
|
Histone H3 Phosphorylation Antibody Panel Pack |
|||
C10014 | EpiGentek |
|
|
Histone H3R2 Methylation Antibody Panel Pack |
|||
C10015 | EpiGentek |
|
|
Histone H3R8 Methylation Antibody Panel Pack |
|||
C10016 | EpiGentek |
|
|
Histone H3R17 Methylation Antibody Panel Pack |
|||
C10017 | EpiGentek |
|
|
Histone H3R26 Methylation Antibody Panel Pack |
|||
C10018 | EpiGentek |
|
|
Histone H4R3 Methylation Antibody Panel Pack |
|||
C10019 | EpiGentek |
|
|
DNA Methylation Antibody Panel Pack I |
|||
C20000 | EpiGentek |
|
|
HRP-Goat Anti-Mouse Secondary Antibody |
|||
A12003 | EpiGentek |
|
|
HRP-Goat Anti-Rabbit Secondary Antibody |
|||
A12004 | EpiGentek |
|
|
Histone H3 Acetylation Antibody Panel Pack I |
|||
C10010 | EpiGentek |
|
|
Histone H3 Acetylation Antibody Panel Pack II |
|||
C10011 | EpiGentek |
|
|
Goat Anti-Rabbit Secondary Antibody, Biotin Conjugated |
|||
A12001 | EpiGentek |
|
|
Goat Anti-Rat Secondary Antibody, Biotin Conjugated |
|||
A12002 | EpiGentek |
|
|
Ataxin 2 antibody |
|||
70R-50365 | Fitzgerald | 100 ul | EUR 292.8 |
Description: Purified Polyclonal Ataxin 2 antibody |
Ataxin 10 antibody |
|||
70R-50914 | Fitzgerald | 100 ul | EUR 292.8 |
Description: Purified Polyclonal Ataxin 10 antibody |
Ataxin 3 antibody |
|||
70R-13630 | Fitzgerald | 100 ul | EUR 548.4 |
Description: Affinity purified Rabbit polyclonal Ataxin 3 antibody |
Ataxin 3 antibody |
|||
22437-100ul | SAB | 100ul | EUR 468 |
Ataxin 3 Antibody |
|||
DF6375 | Affbiotech | 200ul | EUR 420 |
Ataxin-2 Antibody |
|||
R31210 | NSJ Bioreagents | 100 ug | EUR 419 |
Histone H3 Methylation Antibody Panel Pack I – Active Genes |
|||
C10000 | EpiGentek |
|
|
Histone H3 Methylation Antibody Panel Pack I – Repression Genes |
|||
C10001 | EpiGentek |
|
|
Histone H3 Methylation Antibody Panel Pack II – Active Genes |
|||
C10002 | EpiGentek |
|
|
Histone H3 Methylation Antibody Panel Pack II – Repression Genes |
|||
C10003 | EpiGentek |
|
|
Histone H3 Methylation Antibody Panel Pack III – Active Genes |
|||
C10004 | EpiGentek |
|
|
Ataxin 1 Blocking Peptide |
|||
20-abx161786 | Abbexa |
|
|
Ataxin 1 Blocking Peptide |
|||
AF6347-BP | Affbiotech | 1mg | EUR 234 |
These outcomes counsel that ATXN2 is concerned within the pathological strategy of FTLD-TDP. It stays to be clarified whether or not decreased ATXN2 expression induces neurodegeneration by impairing protein synthesis or performs a neuroprotective function by attenuating the toxicity of TDP-43 aggregates in FTLD-TDP and different TDP-43 proteinopathies.