Spinocerebellar ataxia (SCA) is part of the cerebellar neurodegenerative illness group that’s numerous in genetics and phenotypes. It often exhibits autosomal dominant inheritance. SCAs, at all times along with the cerebellar degeneration, could exhibit scientific deficits in brainstem or eye, particularly retina or optic nerve. Apparently, autosomal dominant SCAs share a typical genetic mechanism; the size of the glutamine chain is abnormally expanded because of the improve within the cytosine-adenine-guanine (CAG) repeats of the illness inflicting gene. Research have urged that the mutant ataxin induces alteration of protein conformation and irregular aggregation leading to nuclear inclusions, and causes mobile lack of photoreceptors by way of a poisonous impact.
In consequence, these pathologic modifications induce a downregulation of genes concerned within the phototransduction, growth, and differentiation of photoreceptors resembling CRX, one of many photoreceptor transcription components. Nonetheless, the precise mechanism of neuronal degeneration by mutant ataxin restricted to solely sure sort of neuronal cell together with cerebellar Purkinje neurons and photoreceptor continues to be unclear. The commonest SCAs are varieties 1, 2, 3, 6, 7, and 17 which comprise about 80% of autosomal dominant SCA instances. Numerous elements of eye motion abnormalities are evident relying on the diploma of cerebellar and brainstem degeneration in SCAs. As well as, sure varieties of SCAs resembling SCA7 are characterised by each cerebellar ataxia and visible loss primarily because of retinal degeneration.
The severity of the retinopathy can fluctuate from occult macular photoreceptor disruption to in depth retinal atrophy and is correlated with the variety of CAG repeats. The worth of utilizing optical coherence tomography along side electrodiagnostic and genetic testing is emphasised as the mix of those exams can present vital data concerning the etiology, morphological analysis, and purposeful significances. Due to this fact, ophthalmologists want to acknowledge and differentiate SCAs to be able to correctly diagnose and consider the illness. On this assessment, we’ve described and mentioned SCAs displaying ophthalmic abnormalities with explicit consideration to their ophthalmic options, neurodegenerative mechanisms, genetics, and future views.
The blood-brain barrier is disrupted in Machado-Joseph illness/spinocerebellar ataxia sort 3: proof from transgenic mice and human autopsy samples

Ophthalmic Manifestations and Genetics of the Polyglutamine Autosomal Dominant Spinocerebellar Ataxias: A Review
Hypocretin/orexin loss modifications the hypothalamic immune response.
Ataxin 1 Antibody |
|||
E18-6347-2 | EnoGene | 100μg/100μl | EUR 225 |
Description: Available in various conjugation types. |
Ataxin-1 Antibody |
|||
E90506 | EnoGene | 100μg | EUR 255 |
Description: Available in various conjugation types. |
anti- Ataxin 2 antibody |
|||
FNab00657 | FN Test | 100µg | EUR 606.3 |
Description: Antibody raised against Ataxin 2 |
Ataxin 1 Antibody / ATXN1 |
|||
R32138 | NSJ Bioreagents | 100 ug | EUR 356.15 |
Description: Ataxin-1 is a protein that in humans is encoded by the ATXN1 gene. The ATXN1 gene had been mapped to 6p23 by in situ hybridization. Ataxin-1 (ATXN1), a causative factor for spinocerebellar ataxia type 1 (SCA1), and the related Brother of ATXN1 (BOAT1) are human proteins involved in transcriptional repression. ATXN1 and BOAT1 might participate in several Notch-controlled developmental and pathological processes. |
Ataxin 3 antibody |
|||
22437-100ul | SAB | 100ul | EUR 468 |
Ataxin 3 antibody |
|||
70R-13630 | Fitzgerald | 100 ul | EUR 548.4 |
Description: Affinity purified Rabbit polyclonal Ataxin 3 antibody |
Ataxin 10 antibody |
|||
70R-50914 | Fitzgerald | 100 ul | EUR 292.8 |
Description: Purified Polyclonal Ataxin 10 antibody |
Ataxin 2 antibody |
|||
70R-50365 | Fitzgerald | 100 ul | EUR 292.8 |
Description: Purified Polyclonal Ataxin 2 antibody |
Ataxin 3 Antibody |
|||
DF6375 | Affinity Biosciences | 100ul | EUR 280 |
Description: Human,Mouse,Rat |
Ataxin 3 Antibody |
|||
E300595 | EnoGene | 100ug/200ul | EUR 275 |
Description: Available in various conjugation types. |
Ataxin 7 Antibody |
|||
E300596 | EnoGene | 100ug/200ul | EUR 275 |
Description: Available in various conjugation types. |
Ataxin 10 Antibody |
|||
E38PA2595 | EnoGene | 100ul | EUR 225 |
Description: Available in various conjugation types. |
Ataxin 2 Antibody |
|||
E38PA2046 | EnoGene | 100ul | EUR 225 |
Description: Available in various conjugation types. |
Ataxin 3 Antibody |
|||
DF6375-100ul | Affinity Biosciences | 100ul | EUR 280 |
Ataxin 3 Antibody |
|||
DF6375-200ul | Affinity Biosciences | 200ul | EUR 350 |
Ataxin-1 Polyclonal Antibody |
|||
40621-100ul | SAB | 100ul | EUR 302.4 |
Ataxin-1 Polyclonal Antibody |
|||
40621-50ul | SAB | 50ul | EUR 224.4 |
Ataxin-1 Polyclonal Antibody |
|||
ABP50719-003ml | Abbkine | 0.03ml | EUR 189.6 |
Description: A polyclonal antibody for detection of Ataxin-1 from Human, Mouse. This Ataxin-1 antibody is for WB , IHC-P, IF, ELISA. It is affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogenand is unconjugated. The antibody is produced in rabbit by using as an immunogen synthesized peptide derived from human Ataxin-1 around the non-phosphorylation site of S776 |
Ataxin-1 Polyclonal Antibody |
|||
ABP50719-01ml | Abbkine | 0.1ml | EUR 346.8 |
Description: A polyclonal antibody for detection of Ataxin-1 from Human, Mouse. This Ataxin-1 antibody is for WB , IHC-P, IF, ELISA. It is affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogenand is unconjugated. The antibody is produced in rabbit by using as an immunogen synthesized peptide derived from human Ataxin-1 around the non-phosphorylation site of S776 |
Ataxin-1 Polyclonal Antibody |
|||
ABP50719-02ml | Abbkine | 0.2ml | EUR 496.8 |
Description: A polyclonal antibody for detection of Ataxin-1 from Human, Mouse. This Ataxin-1 antibody is for WB , IHC-P, IF, ELISA. It is affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogenand is unconjugated. The antibody is produced in rabbit by using as an immunogen synthesized peptide derived from human Ataxin-1 around the non-phosphorylation site of S776 |
Ataxin-1 Polyclonal Antibody |
|||
ES1718-100ul | ELK Biotech | 100ul | EUR 334.8 |
Description: A Rabbit Polyclonal antibody against Ataxin-1 from Human/Mouse. This antibody is tested and validated for WB, ELISA, IHC, IF, WB, ELISA |
Ataxin-1 Polyclonal Antibody |
|||
ES1718-50ul | ELK Biotech | 50ul | EUR 248.4 |
Description: A Rabbit Polyclonal antibody against Ataxin-1 from Human/Mouse. This antibody is tested and validated for WB, ELISA, IHC, IF, WB, ELISA |
Ataxin-1 Polyclonal Antibody |
|||
E040621 | EnoGene | 100μg/100μl | EUR 255 |
Description: Available in various conjugation types. |
Ataxin-1 Polyclonal Antibody |
|||
E20-70373 | EnoGene | 100ug | EUR 225 |
Description: Available in various conjugation types. |
Ataxin 1 (ATXN1) Antibody |
|||
20-abx242069 | Abbexa |
|
|
Ataxin 1 (ATXN1) Antibody |
|||
20-abx100304 | Abbexa |
|
|
Ataxin 1 (ATXN1) Antibody |
|||
20-abx171342 | Abbexa |
|
|
Ataxin 1 (ATXN1) Antibody |
|||
20-abx214569 | Abbexa |
|
|
Ataxin 1 (ATXN1) Antibody |
|||
20-abx133167 | Abbexa |
|
|
Ataxin 1 (pS775) Antibody |
|||
20-abx121842 | Abbexa |
|
|
Ataxin 1 (ATXN1) Antibody |
|||
20-abx325351 | Abbexa |
|
|
Ataxin 1 (ATXN1) Antibody |
|||
abx445066-100ug | Abbexa | 100 ug | EUR 627.6 |
Ataxin 1 (ATXN1) Antibody |
|||
abx445084-100ug | Abbexa | 100 ug | EUR 627.6 |
Ataxin 1 (ATXN1) Antibody |
|||
abx031721-400ul | Abbexa | 400 ul | EUR 627.6 |
Ataxin 1 (ATXN1) Antibody |
|||
abx031721-80l | Abbexa | 80 µl | EUR 343.2 |
Ataxin 1 (ATXN1) Antibody |
|||
20-abx126836 | Abbexa |
|
|
Ataxin 1 (ATXN1) Antibody |
|||
20-abx129635 | Abbexa |
|
|
Ataxin 1 (ATXN1) Antibody |
|||
20-abx320078 | Abbexa |
|
|
Ataxin 1 (ATXN1) Antibody |
|||
abx431572-200ul | Abbexa | 200 ul | EUR 343.2 |
Ataxin 1 (ATXN1) Antibody |
|||
abx432383-200ul | Abbexa | 200 ul | EUR 343.2 |
Ataxin 1 (ATXN1) Antibody |
|||
20-abx004749 | Abbexa |
|
|
Ataxin 1 (pS776) Antibody |
|||
abx010423-100ug | Abbexa | 100 ug | EUR 526.8 |
Ataxin 1 (ATXN1) Antibody |
|||
abx010425-100ul | Abbexa | 100 ul | EUR 493.2 |
Ataxin 1 (ATXN1) Antibody |
|||
abx145346-100ug | Abbexa | 100 ug | EUR 469.2 |
Ataxin 1 (pS775) Antibody |
|||
E38PA4341 | EnoGene | 100ul | EUR 225 |
Description: Available in various conjugation types. |
Ataxin-2 Antibody |
|||
R31210 | NSJ Bioreagents | 100 ug | EUR 356.15 |
Description: Ataxin-2, the protein encoded by the ATXN2 gene, contains a polyglutamine tract, long expansions (greater than 33 repeats) of which result in spinocerebellar ataxia-2 (SCA2), an autosomal dominant form of olivopontocerebellar atrophy. The gene for spinocerebellar ataxia type 2(SCA2) has been mapped to 12q24.1. Ataxin-2 associates with L- and T-plastin and overexpression leads to accumulation of T-plastin in mammalian cells. |
Ataxin 3 Antibody / ATXN3 |
|||
F55027-0.08ML | NSJ Bioreagents | 0.08 ml | EUR 140.25 |
Description: ATXN3 was known as spinocerebellar ataxia-3, is an autosomal dominant neurologic disorder. The protein contains (CAG)n repeats in the coding region, and the expansion of these repeats from the normal 13-36 to 68-79 is one cause of Machado-Joseph disease. There is a negative correlation between the age of onset and CAG repeat numbers. |
Ataxin 3 Antibody / ATXN3 |
|||
F55027-0.4ML | NSJ Bioreagents | 0.4 ml | EUR 322.15 |
Description: ATXN3 was known as spinocerebellar ataxia-3, is an autosomal dominant neurologic disorder. The protein contains (CAG)n repeats in the coding region, and the expansion of these repeats from the normal 13-36 to 68-79 is one cause of Machado-Joseph disease. There is a negative correlation between the age of onset and CAG repeat numbers. |
Ataxin 3 Antibody / ATXN3 |
|||
R32137 | NSJ Bioreagents | 100 ug | EUR 356.15 |
Description: ATXN3 (Ataxin 3), also known as AT3, MJD GENE, MJD1, SCA3 GENE, ATX3, JOS, Spinocerebellar ataxia-3, Machado-Joseph disease protein 1, is a protein that in humans is encoded by the ATXN3 gene. ATXN3 ranges in size from 360 to 374 amino acids. Using Northern blot analysis showed that ATXN3 mRNA was ubiquitously expressed in human tissues. They detected at least 4 ATXN3 transcripts of 1.4, 1.8, 4.5, and 7.5 kb and suggested that the different mRNA species probably result from differential splicing and polyadenylation. Machado-Joseph disease, also known as spinocerebellar ataxia-3, is an autosomal dominant neurologic disorder. The protein encoded by the ATXN3 gene contains (CAG)n repeats in the coding region, and the expansion of these repeats from the normal 13-36 to 68-79 is the cause of Machado-Joseph disease. There is an inverse correlation between the age of onset and CAG repeat numbers. Alternatively spliced transcript variants encoding different isoforms have been described for this gene. Ataxin-3 interacted with 2 human homologs of the yeast DNA repair protein RAD23, HHR23A (RAD23A) and HHR23B (RAD23B). Both normal and mutant ataxin-3 proteins interacted with the ubiquitin-like domain at the N terminus of the HHR23 proteins, which is a motif important for nucleotide excision repair. However, in HEK 293 cells, HHR23A was recruited to intranuclear inclusions formed by the mutant ataxin-3 through its interaction with ataxin-3. |
Ataxin 1 (ATXN1) Antibody (RPE) |
|||
abx444428-100ug | Abbexa | 100 ug | EUR 693.6 |
Ataxin 1 (ATXN1) Antibody (RPE) |
|||
abx444446-100ug | Abbexa | 100 ug | EUR 693.6 |
Ataxin 1 (ATXN1) Antibody (HRP) |
|||
abx443585-100ug | Abbexa | 100 ug | EUR 678 |
Ataxin 1 (ATXN1) Antibody (HRP) |
|||
abx443603-100ug | Abbexa | 100 ug | EUR 678 |
Ataxin 1 (ATXN1) Antibody (ALP) |
|||
abx442463-100ug | Abbexa | 100 ug | EUR 693.6 |
Ataxin 1 (ATXN1) Antibody (ALP) |
|||
abx442481-100ug | Abbexa | 100 ug | EUR 693.6 |
Ataxin 1 (ATXN1) Antibody (APC) |
|||
abx442744-100ug | Abbexa | 100 ug | EUR 693.6 |
Ataxin 1 (ATXN1) Antibody (APC) |
|||
abx442762-100ug | Abbexa | 100 ug | EUR 693.6 |
Ataxin 1 (ATXN1) Antibody (FITC) |
|||
abx443304-100ug | Abbexa | 100 ug | EUR 678 |
Ataxin 1 (ATXN1) Antibody (FITC) |
|||
abx443322-100ug | Abbexa | 100 ug | EUR 678 |
Ataxin-2 Antibody / ATXN2 |
|||
R32313 | NSJ Bioreagents | 100 ug | EUR 356.15 |
Description: Ataxin-2, or ATX2, protein is encoded by the ATXN2 gene and contains a polyglutamine tract, long expansions (greater than 33 repeats) of which result in spinocerebellar ataxia-2 (SCA2), an autosomal dominant form of olivopontocerebellar atrophy. The gene for spinocerebellar ataxia type 2 (SCA2) has been mapped to 12q24.1. Ataxin-2 associates with L- and T-plastin and that overexpression of ataxin-2 leads to accumulation of T-plastin in mammalian cells. |
Ataxin 1 Like (ATXN1L) Antibody |
|||
abx030547-400ul | Abbexa | 400 ul | EUR 627.6 |
Ataxin 1 Like (ATXN1L) Antibody |
|||
abx030547-80l | Abbexa | 80 µl | EUR 343.2 |
Ataxin 1 (ATXN1) Antibody (PerCP) |
|||
abx444147-100ug | Abbexa | 100 ug | EUR 693.6 |
Ataxin 1 (ATXN1) Antibody (PerCP) |
|||
abx444165-100ug | Abbexa | 100 ug | EUR 693.6 |
Ataxin 1 Like (ATXN1L) Antibody |
|||
20-abx301794 | Abbexa |
|
|
Ataxin 1 (ATXN1) Antibody (Biotin) |
|||
abx443024-100ug | Abbexa | 100 ug | EUR 693.6 |
Ataxin 1 (ATXN1) Antibody (Biotin) |
|||
abx443042-100ug | Abbexa | 100 ug | EUR 693.6 |
Polyclonal Ataxin 10 Antibody |
|||
APG03169G | Leading Biology | 0.1ml | EUR 580.8 |
Description: A polyclonal antibody raised in Rabbit that recognizes and binds to Human Ataxin 10 . This antibody is tested and proven to work in the following applications: |
Polyclonal Ataxin 2 Antibody |
|||
APG03170G | Leading Biology | 0.1ml | EUR 580.8 |
Description: A polyclonal antibody raised in Rabbit that recognizes and binds to Human Ataxin 2 . This antibody is tested and proven to work in the following applications: |
Phospho- Ataxin 1 (Ser775) Antibody |
|||
ABF3347 | Lifescience Market | 100 ug | EUR 525.6 |
Monoclonal antibody for Ataxin 1 |
|||
SMC-455D | Stressmarq | 0.1mg | EUR 423.6 |
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical).
. The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is not conjugated. |
Monoclonal antibody for Ataxin 1 |
|||
SMC-455D-A390 | Stressmarq | 0.1mg | EUR 480 |
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical).
. The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with ATTO 390. |
Monoclonal antibody for Ataxin 1 |
|||
SMC-455D-A488 | Stressmarq | 0.1mg | EUR 478.8 |
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical).
. The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with ATTO 488. |
Monoclonal antibody for Ataxin 1 |
|||
SMC-455D-A565 | Stressmarq | 0.1mg | EUR 478.8 |
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical).
. The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with ATTO 565. |
Monoclonal antibody for Ataxin 1 |
|||
SMC-455D-A594 | Stressmarq | 0.1mg | EUR 478.8 |
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical).
. The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with ATTO 594. |
Monoclonal antibody for Ataxin 1 |
|||
SMC-455D-A633 | Stressmarq | 0.1mg | EUR 478.8 |
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical).
. The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with ATTO 633. |
Monoclonal antibody for Ataxin 1 |
|||
SMC-455D-A655 | Stressmarq | 0.1mg | EUR 478.8 |
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical).
. The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with ATTO 655. |
Monoclonal antibody for Ataxin 1 |
|||
SMC-455D-A680 | Stressmarq | 0.1mg | EUR 478.8 |
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical).
. The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with ATTO 680. |
Monoclonal antibody for Ataxin 1 |
|||
SMC-455D-A700 | Stressmarq | 0.1mg | EUR 478.8 |
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical).
. The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with ATTO 700. |
Monoclonal antibody for Ataxin 1 |
|||
SMC-455D-ALP | Stressmarq | 0.1mg | EUR 471.6 |
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical).
. The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with Alkaline Phosphatase. |
Monoclonal antibody for Ataxin 1 |
|||
SMC-455D-APC | Stressmarq | 0.1mg | EUR 477.6 |
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical).
. The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with APC. |
Monoclonal antibody for Ataxin 1 |
|||
SMC-455D-APCCY7 | Stressmarq | 0.1mg | EUR 564 |
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical).
. The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with APC/Cy7. |
Monoclonal antibody for Ataxin 1 |
|||
SMC-455D-BI | Stressmarq | 0.1mg | EUR 474 |
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical).
. The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with Biotin. |
Monoclonal antibody for Ataxin 1 |
|||
SMC-455D-DY350 | Stressmarq | 0.1mg | EUR 495.6 |
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical).
. The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with Dylight 350. |
Monoclonal antibody for Ataxin 1 |
|||
SMC-455D-DY405 | Stressmarq | 0.1mg | EUR 482.4 |
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical).
. The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with Dylight 405. |
Monoclonal antibody for Ataxin 1 |
|||
SMC-455D-DY488 | Stressmarq | 0.1mg | EUR 470.4 |
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical).
. The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with Dylight 488. |
Monoclonal antibody for Ataxin 1 |
|||
SMC-455D-DY594 | Stressmarq | 0.1mg | EUR 472.8 |
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical).
. The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with Dylight 594. |
Monoclonal antibody for Ataxin 1 |
|||
SMC-455D-DY633 | Stressmarq | 0.1mg | EUR 466.8 |
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical).
. The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with Dylight 633. |
Monoclonal antibody for Ataxin 1 |
|||
SMC-455D-FITC | Stressmarq | 0.1mg | EUR 469.2 |
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical).
. The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with FITC. |
Monoclonal antibody for Ataxin 1 |
|||
SMC-455D-HRP | Stressmarq | 0.1mg | EUR 464.4 |
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical).
. The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with HRP. |
Monoclonal antibody for Ataxin 1 |
|||
SMC-455D-P594 | Stressmarq | 0.1mg | EUR 487.2 |
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical).
. The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with PE/ATTO 594. |
Monoclonal antibody for Ataxin 1 |
|||
SMC-455D-PCP | Stressmarq | 0.1mg | EUR 477.6 |
Description: A monoclonal antibody from clone S76-8 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical).
. The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with PerCP. |
Monoclonal antibody for Ataxin 1 |
|||
SMC-455D-RPE | Stressmarq | 0.1mg | EUR 475.2 |
Description: A monoclonal antibody from clone S76-8 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical).
. The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with RPE. |
Monoclonal antibody for Ataxin 1 |
|||
SMC-455D-STR | Stressmarq | 0.1mg | EUR 476.4 |
Description: A monoclonal antibody from clone S76-8 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical).
. The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with Streptavidin. |
Monoclonal antibody for Ataxin 1 |
|||
SMC-455S | Stressmarq | 0.012mg | EUR 78 |
Description: A monoclonal antibody from clone S76-8 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical).
. The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is not conjugated. |
Monoclonal antibody for Ataxin 1 |
|||
SMC-475D | Stressmarq | 0.1mg | EUR 423.6 |
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical).
. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is not conjugated. |
Monoclonal antibody for Ataxin 1 |
|||
SMC-475D-A390 | Stressmarq | 0.1mg | EUR 480 |
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical).
. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with ATTO 390. |
Monoclonal antibody for Ataxin 1 |
|||
SMC-475D-A488 | Stressmarq | 0.1mg | EUR 478.8 |
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical).
. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with ATTO 488. |
Monoclonal antibody for Ataxin 1 |
|||
SMC-475D-A565 | Stressmarq | 0.1mg | EUR 478.8 |
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical).
. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with ATTO 565. |
Monoclonal antibody for Ataxin 1 |
|||
SMC-475D-A594 | Stressmarq | 0.1mg | EUR 478.8 |
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical).
. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with ATTO 594. |
Monoclonal antibody for Ataxin 1 |
|||
SMC-475D-A633 | Stressmarq | 0.1mg | EUR 478.8 |
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical).
. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with ATTO 633. |
Monoclonal antibody for Ataxin 1 |
|||
SMC-475D-A655 | Stressmarq | 0.1mg | EUR 478.8 |
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical).
. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with ATTO 655. |
Monoclonal antibody for Ataxin 1 |
|||
SMC-475D-A680 | Stressmarq | 0.1mg | EUR 478.8 |
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical).
. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with ATTO 680. |
Monoclonal antibody for Ataxin 1 |
|||
SMC-475D-A700 | Stressmarq | 0.1mg | EUR 478.8 |
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical).
. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with ATTO 700. |
Monoclonal antibody for Ataxin 1 |
|||
SMC-475D-ALP | Stressmarq | 0.1mg | EUR 471.6 |
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical).
. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with Alkaline Phosphatase. |
Monoclonal antibody for Ataxin 1 |
|||
SMC-475D-APC | Stressmarq | 0.1mg | EUR 477.6 |
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical).
. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with APC. |
Monoclonal antibody for Ataxin 1 |
|||
SMC-475D-APCCY7 | Stressmarq | 0.1mg | EUR 564 |
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical).
. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with APC/Cy7. |
Monoclonal antibody for Ataxin 1 |
|||
SMC-475D-BI | Stressmarq | 0.1mg | EUR 474 |
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical).
. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with Biotin. |
Monoclonal antibody for Ataxin 1 |
|||
SMC-475D-DY350 | Stressmarq | 0.1mg | EUR 495.6 |
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical).
. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with Dylight 350. |
Monoclonal antibody for Ataxin 1 |
|||
SMC-475D-DY405 | Stressmarq | 0.1mg | EUR 482.4 |
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical).
. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with Dylight 405. |
Monoclonal antibody for Ataxin 1 |
|||
SMC-475D-DY488 | Stressmarq | 0.1mg | EUR 470.4 |
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical).
. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with Dylight 488. |
Monoclonal antibody for Ataxin 1 |
|||
SMC-475D-DY594 | Stressmarq | 0.1mg | EUR 472.8 |
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical).
. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with Dylight 594. |
Monoclonal antibody for Ataxin 1 |
|||
SMC-475D-DY633 | Stressmarq | 0.1mg | EUR 466.8 |
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical).
. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with Dylight 633. |
Monoclonal antibody for Ataxin 1 |
|||
SMC-475D-FITC | Stressmarq | 0.1mg | EUR 469.2 |
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical).
. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with FITC. |
Monoclonal antibody for Ataxin 1 |
|||
SMC-475D-HRP | Stressmarq | 0.1mg | EUR 464.4 |
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical).
. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with HRP. |
Monoclonal antibody for Ataxin 1 |
|||
SMC-475D-P594 | Stressmarq | 0.1mg | EUR 487.2 |
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical).
. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with PE/ATTO 594. |
Monoclonal antibody for Ataxin 1 |
|||
SMC-475D-PCP | Stressmarq | 0.1mg | EUR 477.6 |
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical).
. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with PerCP. |
Monoclonal antibody for Ataxin 1 |
|||
SMC-475D-RPE | Stressmarq | 0.1mg | EUR 475.2 |
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical).
. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with RPE. |
Monoclonal antibody for Ataxin 1 |
|||
SMC-475D-STR | Stressmarq | 0.1mg | EUR 476.4 |
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical).
. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with Streptavidin. |
Monoclonal antibody for Ataxin 1 |
|||
SMC-475S | Stressmarq | 0.012mg | EUR 78 |
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical).
. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is not conjugated. |
Ataxin-1 Polyclonal Conjugated Antibody |
|||
C40621 | SAB | 100ul | EUR 476.4 |
Ataxin-3 (pS256) Antibody |
|||
abx148457-100ug | Abbexa | 100 ug | EUR 526.8 |
Ataxin 1 (Phospho-Ser776) Antibody |
|||
12034-100ul | SAB | 100ul | EUR 302.4 |
Ataxin 1 (Phospho-Ser776) Antibody |
|||
12034-50ul | SAB | 50ul | EUR 224.4 |
Ataxin 1 (Phospho-Ser776) Antibody |
|||
E11-0771A | EnoGene | 100μg | EUR 225 |
Description: Available in various conjugation types. |
Ataxin 1 (Phospho-Ser776) Antibody |
|||
E012034 | EnoGene | 100μg/100μl | EUR 255 |
Description: Available in various conjugation types. |
Ataxin 1 (ATXN1) Polyclonal Antibody |
|||
CAU27779-100ul | Biomatik Corporation | 100ul | EUR 217.9 |
Ataxin 1 (ATXN1) Polyclonal Antibody |
|||
CAU27779-200ul | Biomatik Corporation | 200ul | EUR 272.2 |
Ataxin 1 (ATXN1) Polyclonal Antibody |
|||
CAU27780-100ul | Biomatik Corporation | 100ul | EUR 212.2 |
Ataxin 1 (ATXN1) Polyclonal Antibody |
|||
CAU27780-200ul | Biomatik Corporation | 200ul | EUR 265.4 |
Ataxin 1 (ATXN1) Antibody (ATTO 390) |
|||
abx440215-100ug | Abbexa | 100 ug | EUR 693.6 |
Ataxin 1 (ATXN1) Antibody (ATTO 390) |
|||
abx440233-100ug | Abbexa | 100 ug | EUR 693.6 |
Ataxin 1 (ATXN1) Antibody (ATTO 488) |
|||
abx440496-100ug | Abbexa | 100 ug | EUR 693.6 |
Ataxin 1 (ATXN1) Antibody (ATTO 488) |
|||
abx440514-100ug | Abbexa | 100 ug | EUR 693.6 |
Ataxin 1 (ATXN1) Antibody (ATTO 565) |
|||
abx440777-100ug | Abbexa | 100 ug | EUR 693.6 |
Ataxin 1 (ATXN1) Antibody (ATTO 565) |
|||
abx440795-100ug | Abbexa | 100 ug | EUR 693.6 |
Ataxin 1 (ATXN1) Antibody (ATTO 594) |
|||
abx441058-100ug | Abbexa | 100 ug | EUR 693.6 |
Ataxin 1 (ATXN1) Antibody (ATTO 594) |
|||
abx441076-100ug | Abbexa | 100 ug | EUR 693.6 |
Ataxin 1 (ATXN1) Antibody (ATTO 633) |
|||
abx441339-100ug | Abbexa | 100 ug | EUR 693.6 |
Ataxin 1 (ATXN1) Antibody (ATTO 633) |
|||
abx441357-100ug | Abbexa | 100 ug | EUR 693.6 |
Ataxin 1 (ATXN1) Antibody (ATTO 655) |
|||
abx441620-100ug | Abbexa | 100 ug | EUR 693.6 |
Ataxin 1 (ATXN1) Antibody (ATTO 655) |
|||
abx441638-100ug | Abbexa | 100 ug | EUR 693.6 |
Ataxin 1 (ATXN1) Antibody (ATTO 680) |
|||
abx441901-100ug | Abbexa | 100 ug | EUR 693.6 |
Ataxin 1 (ATXN1) Antibody (ATTO 680) |
|||
abx441919-100ug | Abbexa | 100 ug | EUR 693.6 |
Ataxin 1 (ATXN1) Antibody (ATTO 700) |
|||
abx442182-100ug | Abbexa | 100 ug | EUR 693.6 |
Ataxin 1 (ATXN1) Antibody (ATTO 700) |
|||
abx442200-100ug | Abbexa | 100 ug | EUR 693.6 |
Ataxin 1 (ATXN1) Antibody (Streptavidin) |
|||
abx444709-100ug | Abbexa | 100 ug | EUR 693.6 |
Ataxin 1 (ATXN1) Antibody (Streptavidin) |
|||
abx444727-100ug | Abbexa | 100 ug | EUR 693.6 |
Ataxin 1 Like (ATXN1L) Antibody (HRP) |
|||
20-abx314758 | Abbexa |
|
|
Ataxin 7 Like 1 (ATXN7L1) Antibody |
|||
20-abx325156 | Abbexa |
|
|
Ataxin 1 Like (ATXN1L) Antibody (FITC) |
|||
20-abx314759 | Abbexa |
|
|
Ataxin-2 Polyclonal Antibody |
|||
40622-100ul | SAB | 100ul | EUR 302.4 |
Ataxin-2 Polyclonal Antibody |
|||
40622-50ul | SAB | 50ul | EUR 224.4 |
Ataxin-2 Polyclonal Antibody |
|||
ABP50720-003ml | Abbkine | 0.03ml | EUR 189.6 |
Description: A polyclonal antibody for detection of Ataxin-2 from Human. This Ataxin-2 antibody is for WB , IHC-P, ELISA. It is affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogenand is unconjugated. The antibody is produced in rabbit by using as an immunogen synthesized peptide derived from the Internal region of human Ataxin-2 at AA range: 700-780 |