Spinocerebellar ataxia (SCA) is part of the cerebellar neurodegenerative illness group that’s numerous in genetics and phenotypes. It often exhibits autosomal dominant inheritance. SCAs, at all times along with the cerebellar degeneration, could exhibit scientific deficits in brainstem or eye, particularly retina or optic nerve. Apparently, autosomal dominant SCAs share a typical genetic mechanism; the size of the glutamine chain is abnormally expanded because of the improve within the cytosine-adenine-guanine (CAG) repeats of the illness inflicting gene. Research have urged that the mutant ataxin induces alteration of protein conformation and irregular aggregation leading to nuclear inclusions, and causes mobile lack of photoreceptors by way of a poisonous impact.
In consequence, these pathologic modifications induce a downregulation of genes concerned within the phototransduction, growth, and differentiation of photoreceptors resembling CRX, one of many photoreceptor transcription components. Nonetheless, the precise mechanism of neuronal degeneration by mutant ataxin restricted to solely sure sort of neuronal cell together with cerebellar Purkinje neurons and photoreceptor continues to be unclear. The commonest SCAs are varieties 1, 2, 3, 6, 7, and 17 which comprise about 80% of autosomal dominant SCA instances. Numerous elements of eye motion abnormalities are evident relying on the diploma of cerebellar and brainstem degeneration in SCAs. As well as, sure varieties of SCAs resembling SCA7 are characterised by each cerebellar ataxia and visible loss primarily because of retinal degeneration.
The severity of the retinopathy can fluctuate from occult macular photoreceptor disruption to in depth retinal atrophy and is correlated with the variety of CAG repeats. The worth of utilizing optical coherence tomography along side electrodiagnostic and genetic testing is emphasised as the mix of those exams can present vital data concerning the etiology, morphological analysis, and purposeful significances. Due to this fact, ophthalmologists want to acknowledge and differentiate SCAs to be able to correctly diagnose and consider the illness. On this assessment, we’ve described and mentioned SCAs displaying ophthalmic abnormalities with explicit consideration to their ophthalmic options, neurodegenerative mechanisms, genetics, and future views.
The blood-brain barrier is disrupted in Machado-Joseph illness/spinocerebellar ataxia sort 3: proof from transgenic mice and human autopsy samples

Ophthalmic Manifestations and Genetics of the Polyglutamine Autosomal Dominant Spinocerebellar Ataxias: A Review
Hypocretin/orexin loss modifications the hypothalamic immune response.
![]() Anti-Ataxin 1 (4C5) |
|||
YF-MA15341 | Abfrontier | 100 ug | EUR 363 |
Description: Mouse monoclonal to Ataxin 1 |
![]() Ataxin 1 Antibody |
|||
AF6347 | Affbiotech | 200ul | EUR 304 |
Description: Ataxin 1 Antibody detects endogenous levels of total Ataxin 1. |
![]() Ataxin 1 Antibody |
|||
ABF6347 | Lifescience Market | 100 ug | EUR 438 |
![]() Anti-Phospho-Ataxin-1 (S776) antibody |
|||
STJ90696 | St John's Laboratory | 200 µl | EUR 197 |
Description: Rabbit polyclonal to Phospho-Ataxin-1 (S776). |
![]() Anti-Ataxin 2 antibody |
|||
PAab00657 | Lifescience Market | 100 ug | EUR 355 |
![]() Anti-Ataxin-2L Antibody |
|||
A08149 | BosterBio | 100ul | EUR 397 |
Description: Rabbit Polyclonal Antibody for Ataxin-2L Antibody (ATXN2L) detection. Tested with WB in Human. |
![]() Anti-Ataxin-2 antibody |
|||
STJ91739 | St John's Laboratory | 200 µl | EUR 197 |
Description: Rabbit polyclonal to Ataxin-2. |
![]() Anti-Ataxin-2L antibody |
|||
STJ91740 | St John's Laboratory | 200 µl | EUR 197 |
Description: Rabbit polyclonal to Ataxin-2L. |
![]() Anti-Ataxin-7L1 antibody |
|||
STJ91741 | St John's Laboratory | 200 µl | EUR 197 |
Description: Rabbit polyclonal to Ataxin-7L1. |
![]() anti- Ataxin 2 antibody |
|||
FNab00657 | FN Test | 100µg | EUR 505.25 |
Description: Antibody raised against Ataxin 2 |
![]() Ataxin-1 Polyclonal Antibody |
|||
ABP50719-003ml | Abbkine | 0.03ml | EUR 158 |
Description: A polyclonal antibody for detection of Ataxin-1 from Human, Mouse. This Ataxin-1 antibody is for WB , IHC-P, IF, ELISA. It is affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogenand is unconjugated. The antibody is produced in rabbit by using as an immunogen synthesized peptide derived from human Ataxin-1 around the non-phosphorylation site of S776 |
![]() Ataxin-1 Polyclonal Antibody |
|||
ABP50719-01ml | Abbkine | 0.1ml | EUR 289 |
Description: A polyclonal antibody for detection of Ataxin-1 from Human, Mouse. This Ataxin-1 antibody is for WB , IHC-P, IF, ELISA. It is affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogenand is unconjugated. The antibody is produced in rabbit by using as an immunogen synthesized peptide derived from human Ataxin-1 around the non-phosphorylation site of S776 |
![]() Ataxin-1 Polyclonal Antibody |
|||
ABP50719-02ml | Abbkine | 0.2ml | EUR 414 |
Description: A polyclonal antibody for detection of Ataxin-1 from Human, Mouse. This Ataxin-1 antibody is for WB , IHC-P, IF, ELISA. It is affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogenand is unconjugated. The antibody is produced in rabbit by using as an immunogen synthesized peptide derived from human Ataxin-1 around the non-phosphorylation site of S776 |
![]() Ataxin 1 (ATXN1) Antibody |
|||
20-abx126836 | Abbexa |
|
|
![]() Ataxin 1 (ATXN1) Antibody |
|||
20-abx129635 | Abbexa |
|
|
![]() Ataxin 1 (pS775) Antibody |
|||
20-abx121842 | Abbexa |
|
|
![]() Ataxin 1 (ATXN1) Antibody |
|||
20-abx320078 | Abbexa |
|
|
![]() Ataxin 1 (ATXN1) Antibody |
|||
abx431572-200ul | Abbexa | 200 ul | EUR 286 |
![]() Ataxin 1 (ATXN1) Antibody |
|||
abx432383-200ul | Abbexa | 200 ul | EUR 286 |
![]() Ataxin 1 (ATXN1) Antibody |
|||
abx445066-100ug | Abbexa | 100 ug | EUR 523 |
![]() Ataxin 1 (ATXN1) Antibody |
|||
abx445084-100ug | Abbexa | 100 ug | EUR 523 |
![]() Ataxin 1 (ATXN1) Antibody |
|||
20-abx242069 | Abbexa |
|
|
![]() Ataxin 1 (ATXN1) Antibody |
|||
20-abx214569 | Abbexa |
|
|
![]() Ataxin 1 (ATXN1) Antibody |
|||
20-abx171342 | Abbexa |
|
|
![]() Ataxin 1 (ATXN1) Antibody |
|||
20-abx325351 | Abbexa |
|
|
![]() Ataxin 1 (ATXN1) Antibody |
|||
20-abx004749 | Abbexa |
|
|
![]() Ataxin 1 (ATXN1) Antibody |
|||
20-abx100304 | Abbexa |
|
|
![]() Ataxin 1 (ATXN1) Antibody |
|||
20-abx133167 | Abbexa |
|
|
![]() Ataxin 1 (ATXN1) Antibody |
|||
abx145346-100ug | Abbexa | 100 ug | EUR 391 |
![]() Ataxin 1 (pS776) Antibody |
|||
abx010423-100ug | Abbexa | 100 ug | EUR 439 |
![]() Ataxin 1 (ATXN1) Antibody |
|||
abx010425-100ul | Abbexa | 100 ul | EUR 411 |
![]() Ataxin 1 (ATXN1) Antibody |
|||
abx031721-400ul | Abbexa | 400 ul | EUR 523 |
![]() Ataxin 1 (ATXN1) Antibody |
|||
abx031721-80l | Abbexa | 80 µl | EUR 286 |
![]() Ataxin-1 Polyclonal Antibody |
|||
ES1718-100ul | ELK Biotech | 100ul | EUR 279 |
Description: A Rabbit Polyclonal antibody against Ataxin-1 from Human/Mouse. This antibody is tested and validated for WB, ELISA, IHC, IF, WB, ELISA |
![]() Ataxin-1 Polyclonal Antibody |
|||
ES1718-50ul | ELK Biotech | 50ul | EUR 207 |
Description: A Rabbit Polyclonal antibody against Ataxin-1 from Human/Mouse. This antibody is tested and validated for WB, ELISA, IHC, IF, WB, ELISA |
![]() Ataxin-1 Polyclonal Antibody |
|||
40621-100ul | SAB | 100ul | EUR 252 |
![]() Ataxin-1 Polyclonal Antibody |
|||
40621-50ul | SAB | 50ul | EUR 187 |
![]() Anti-Ataxin 3/ATXN3 Antibody |
|||
PA1846 | BosterBio | 100ug/vial | EUR 334 |
![]() Anti-Ataxin 3/ATXN3 Antibody |
|||
PB9423 | BosterBio | 100ug/vial | EUR 334 |
![]() Phospho-Ataxin 1 (Ser775) Antibody |
|||
AF3347 | Affbiotech | 200ul | EUR 304 |
Description: Phospho-Ataxin 1 (Ser775) Antibody detects endogenous levels of Ataxin 1 only when phosphorylated at Serine 775. |
![]() Phospho- Ataxin 1 (Ser775) Antibody |
|||
ABF3347 | Lifescience Market | 100 ug | EUR 438 |
![]() Ataxin 1 (ATXN1) Antibody (ALP) |
|||
abx442463-100ug | Abbexa | 100 ug | EUR 578 |
![]() Ataxin 1 (ATXN1) Antibody (ALP) |
|||
abx442481-100ug | Abbexa | 100 ug | EUR 578 |
![]() Ataxin 1 (ATXN1) Antibody (APC) |
|||
abx442744-100ug | Abbexa | 100 ug | EUR 578 |
![]() Ataxin 1 (ATXN1) Antibody (APC) |
|||
abx442762-100ug | Abbexa | 100 ug | EUR 578 |
![]() Ataxin 1 (ATXN1) Antibody (Biotin) |
|||
abx443024-100ug | Abbexa | 100 ug | EUR 578 |
![]() Ataxin 1 (ATXN1) Antibody (Biotin) |
|||
abx443042-100ug | Abbexa | 100 ug | EUR 578 |
![]() Ataxin 1 (ATXN1) Antibody (FITC) |
|||
abx443304-100ug | Abbexa | 100 ug | EUR 565 |
![]() Ataxin 1 (ATXN1) Antibody (FITC) |
|||
abx443322-100ug | Abbexa | 100 ug | EUR 565 |
![]() Ataxin 1 (ATXN1) Antibody (HRP) |
|||
abx443585-100ug | Abbexa | 100 ug | EUR 565 |
![]() Ataxin 1 (ATXN1) Antibody (HRP) |
|||
abx443603-100ug | Abbexa | 100 ug | EUR 565 |
![]() Ataxin 1 (ATXN1) Antibody (PerCP) |
|||
abx444147-100ug | Abbexa | 100 ug | EUR 578 |
![]() Ataxin 1 (ATXN1) Antibody (PerCP) |
|||
abx444165-100ug | Abbexa | 100 ug | EUR 578 |
![]() Ataxin 1 (ATXN1) Antibody (RPE) |
|||
abx444428-100ug | Abbexa | 100 ug | EUR 578 |
![]() Ataxin 1 (ATXN1) Antibody (RPE) |
|||
abx444446-100ug | Abbexa | 100 ug | EUR 578 |
![]() Ataxin 1 (ATXN1) Antibody (Streptavidin) |
|||
abx444709-100ug | Abbexa | 100 ug | EUR 578 |
![]() Ataxin 1 (ATXN1) Antibody (Streptavidin) |
|||
abx444727-100ug | Abbexa | 100 ug | EUR 578 |
![]() Ataxin 1 Like (ATXN1L) Antibody |
|||
20-abx301794 | Abbexa |
|
|
![]() Ataxin 1 Like (ATXN1L) Antibody |
|||
abx030547-400ul | Abbexa | 400 ul | EUR 523 |
![]() Ataxin 1 Like (ATXN1L) Antibody |
|||
abx030547-80l | Abbexa | 80 µl | EUR 286 |
![]() Ataxin 1 (Phospho-Ser776) Antibody |
|||
12034-100ul | SAB | 100ul | EUR 252 |
![]() Ataxin 1 (Phospho-Ser776) Antibody |
|||
12034-50ul | SAB | 50ul | EUR 187 |
![]() Monoclonal antibody for Ataxin 1 |
|||
SMC-455D | Stressmarq | 0.1mg | EUR 353 |
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical).
. The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is not conjugated. |
![]() Monoclonal antibody for Ataxin 1 |
|||
SMC-455D-A390 | Stressmarq | 0.1mg | EUR 400 |
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical).
. The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with ATTO 390. |
![]() Monoclonal antibody for Ataxin 1 |
|||
SMC-455D-A488 | Stressmarq | 0.1mg | EUR 399 |
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical).
. The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with ATTO 488. |
![]() Monoclonal antibody for Ataxin 1 |
|||
SMC-455D-A565 | Stressmarq | 0.1mg | EUR 399 |
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical).
. The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with ATTO 565. |
![]() Monoclonal antibody for Ataxin 1 |
|||
SMC-455D-A594 | Stressmarq | 0.1mg | EUR 399 |
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical).
. The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with ATTO 594. |
![]() Monoclonal antibody for Ataxin 1 |
|||
SMC-455D-A633 | Stressmarq | 0.1mg | EUR 399 |
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical).
. The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with ATTO 633. |
![]() Monoclonal antibody for Ataxin 1 |
|||
SMC-455D-A655 | Stressmarq | 0.1mg | EUR 399 |
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical).
. The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with ATTO 655. |
![]() Monoclonal antibody for Ataxin 1 |
|||
SMC-455D-A680 | Stressmarq | 0.1mg | EUR 399 |
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical).
. The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with ATTO 680. |
![]() Monoclonal antibody for Ataxin 1 |
|||
SMC-455D-A700 | Stressmarq | 0.1mg | EUR 399 |
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical).
. The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with ATTO 700. |
![]() Monoclonal antibody for Ataxin 1 |
|||
SMC-455D-ALP | Stressmarq | 0.1mg | EUR 393 |
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical).
. The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with Alkaline Phosphatase. |
![]() Monoclonal antibody for Ataxin 1 |
|||
SMC-455D-APC | Stressmarq | 0.1mg | EUR 398 |
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical).
. The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with APC. |
![]() Monoclonal antibody for Ataxin 1 |
|||
SMC-455D-APCCY7 | Stressmarq | 0.1mg | EUR 470 |
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical).
. The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with APC/Cy7. |
![]() Monoclonal antibody for Ataxin 1 |
|||
SMC-455D-BI | Stressmarq | 0.1mg | EUR 395 |
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical).
. The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with Biotin. |
![]() Monoclonal antibody for Ataxin 1 |
|||
SMC-455D-DY350 | Stressmarq | 0.1mg | EUR 413 |
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical).
. The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with Dylight 350. |
![]() Monoclonal antibody for Ataxin 1 |
|||
SMC-455D-DY405 | Stressmarq | 0.1mg | EUR 402 |
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical).
. The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with Dylight 405. |
![]() Monoclonal antibody for Ataxin 1 |
|||
SMC-455D-DY488 | Stressmarq | 0.1mg | EUR 392 |
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical).
. The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with Dylight 488. |
![]() Monoclonal antibody for Ataxin 1 |
|||
SMC-455D-DY594 | Stressmarq | 0.1mg | EUR 394 |
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical).
. The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with Dylight 594. |
![]() Monoclonal antibody for Ataxin 1 |
|||
SMC-455D-DY633 | Stressmarq | 0.1mg | EUR 389 |
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical).
. The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with Dylight 633. |
![]() Monoclonal antibody for Ataxin 1 |
|||
SMC-455D-FITC | Stressmarq | 0.1mg | EUR 391 |
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical).
. The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with FITC. |
![]() Monoclonal antibody for Ataxin 1 |
|||
SMC-455D-HRP | Stressmarq | 0.1mg | EUR 387 |
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical).
. The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with HRP. |
![]() Monoclonal antibody for Ataxin 1 |
|||
SMC-455D-P594 | Stressmarq | 0.1mg | EUR 406 |
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical).
. The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with PE/ATTO 594. |
![]() Monoclonal antibody for Ataxin 1 |
|||
SMC-455D-PCP | Stressmarq | 0.1mg | EUR 398 |
Description: A monoclonal antibody from clone S76-8 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical).
. The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with PerCP. |
![]() Monoclonal antibody for Ataxin 1 |
|||
SMC-455D-RPE | Stressmarq | 0.1mg | EUR 396 |
Description: A monoclonal antibody from clone S76-8 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical).
. The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with RPE. |
![]() Monoclonal antibody for Ataxin 1 |
|||
SMC-455D-STR | Stressmarq | 0.1mg | EUR 397 |
Description: A monoclonal antibody from clone S76-8 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical).
. The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with Streptavidin. |
![]() Monoclonal antibody for Ataxin 1 |
|||
SMC-455S | Stressmarq | 0.012mg | EUR 65 |
Description: A monoclonal antibody from clone S76-8 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical).
. The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is not conjugated. |
![]() Monoclonal antibody for Ataxin 1 |
|||
SMC-475D | Stressmarq | 0.1mg | EUR 353 |
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical).
. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is not conjugated. |
![]() Monoclonal antibody for Ataxin 1 |
|||
SMC-475D-A390 | Stressmarq | 0.1mg | EUR 400 |
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical).
. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with ATTO 390. |
![]() Monoclonal antibody for Ataxin 1 |
|||
SMC-475D-A488 | Stressmarq | 0.1mg | EUR 399 |
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical).
. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with ATTO 488. |
![]() Monoclonal antibody for Ataxin 1 |
|||
SMC-475D-A565 | Stressmarq | 0.1mg | EUR 399 |
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical).
. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with ATTO 565. |
![]() Monoclonal antibody for Ataxin 1 |
|||
SMC-475D-A594 | Stressmarq | 0.1mg | EUR 399 |
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical).
. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with ATTO 594. |
![]() Monoclonal antibody for Ataxin 1 |
|||
SMC-475D-A633 | Stressmarq | 0.1mg | EUR 399 |
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical).
. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with ATTO 633. |
![]() Monoclonal antibody for Ataxin 1 |
|||
SMC-475D-A655 | Stressmarq | 0.1mg | EUR 399 |
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical).
. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with ATTO 655. |
![]() Monoclonal antibody for Ataxin 1 |
|||
SMC-475D-A680 | Stressmarq | 0.1mg | EUR 399 |
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical).
. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with ATTO 680. |
![]() Monoclonal antibody for Ataxin 1 |
|||
SMC-475D-A700 | Stressmarq | 0.1mg | EUR 399 |
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical).
. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with ATTO 700. |
![]() Monoclonal antibody for Ataxin 1 |
|||
SMC-475D-ALP | Stressmarq | 0.1mg | EUR 393 |
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical).
. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with Alkaline Phosphatase. |
![]() Monoclonal antibody for Ataxin 1 |
|||
SMC-475D-APC | Stressmarq | 0.1mg | EUR 398 |
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical).
. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with APC. |
![]() Monoclonal antibody for Ataxin 1 |
|||
SMC-475D-APCCY7 | Stressmarq | 0.1mg | EUR 470 |
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical).
. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with APC/Cy7. |
![]() Monoclonal antibody for Ataxin 1 |
|||
SMC-475D-BI | Stressmarq | 0.1mg | EUR 395 |
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical).
. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with Biotin. |
![]() Monoclonal antibody for Ataxin 1 |
|||
SMC-475D-DY350 | Stressmarq | 0.1mg | EUR 413 |
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical).
. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with Dylight 350. |
![]() Monoclonal antibody for Ataxin 1 |
|||
SMC-475D-DY405 | Stressmarq | 0.1mg | EUR 402 |
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical).
. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with Dylight 405. |
![]() Monoclonal antibody for Ataxin 1 |
|||
SMC-475D-DY488 | Stressmarq | 0.1mg | EUR 392 |
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical).
. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with Dylight 488. |
![]() Monoclonal antibody for Ataxin 1 |
|||
SMC-475D-DY594 | Stressmarq | 0.1mg | EUR 394 |
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical).
. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with Dylight 594. |
![]() Monoclonal antibody for Ataxin 1 |
|||
SMC-475D-DY633 | Stressmarq | 0.1mg | EUR 389 |
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical).
. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with Dylight 633. |
![]() Monoclonal antibody for Ataxin 1 |
|||
SMC-475D-FITC | Stressmarq | 0.1mg | EUR 391 |
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical).
. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with FITC. |
![]() Monoclonal antibody for Ataxin 1 |
|||
SMC-475D-HRP | Stressmarq | 0.1mg | EUR 387 |
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical).
. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with HRP. |
![]() Monoclonal antibody for Ataxin 1 |
|||
SMC-475D-P594 | Stressmarq | 0.1mg | EUR 406 |
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical).
. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with PE/ATTO 594. |
![]() Monoclonal antibody for Ataxin 1 |
|||
SMC-475D-PCP | Stressmarq | 0.1mg | EUR 398 |
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical).
. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with PerCP. |
![]() Monoclonal antibody for Ataxin 1 |
|||
SMC-475D-RPE | Stressmarq | 0.1mg | EUR 396 |
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical).
. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with RPE. |
![]() Monoclonal antibody for Ataxin 1 |
|||
SMC-475D-STR | Stressmarq | 0.1mg | EUR 397 |
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical).
. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with Streptavidin. |
![]() Monoclonal antibody for Ataxin 1 |
|||
SMC-475S | Stressmarq | 0.012mg | EUR 65 |
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical).
. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is not conjugated. |
![]() Ataxin-1 Polyclonal Conjugated Antibody |
|||
C40621 | SAB | 100ul | EUR 397 |
![]() Polyclonal Goat anti-GST μ-form |
|||
GST-ANTI-2 | Detroit R&D | 50 uL | EUR 280 |
![]() Polyclonal Goat anti-GST p-form |
|||
GST-ANTI-3 | Detroit R&D | 50 uL | EUR 280 |
![]() Ataxin 1 Blocking Peptide |
|||
AF6347-BP | Affbiotech | 1mg | EUR 195 |
![]() Recombinant Ataxin 1 (ATXN1) |
|||
4-RPA514Hu01 | Cloud-Clone |
|
|
Description: Recombinant Human Ataxin 1 expressed in: E.coli |
![]() Recombinant Ataxin 1 (ATXN1) |
|||
4-RPA514Mu01 | Cloud-Clone |
|
|
Description: Recombinant Mouse Ataxin 1 expressed in: E.coli |
![]() Ataxin 1 Blocking Peptide |
|||
20-abx161786 | Abbexa |
|
|
![]() Ataxin 2 antibody |
|||
70R-50365 | Fitzgerald | 100 ul | EUR 244 |
Description: Purified Polyclonal Ataxin 2 antibody |
![]() Ataxin 10 antibody |
|||
70R-50914 | Fitzgerald | 100 ul | EUR 244 |
Description: Purified Polyclonal Ataxin 10 antibody |
![]() Ataxin 3 antibody |
|||
70R-13630 | Fitzgerald | 100 ul | EUR 457 |
Description: Affinity purified Rabbit polyclonal Ataxin 3 antibody |
![]() Ataxin 3 antibody |
|||
22437-100ul | SAB | 100ul | EUR 390 |
![]() Ataxin 1 (ATXN1) Polyclonal Antibody (Mouse) |
|||
4-PAA514Mu01 | Cloud-Clone |
|
|
Description: A Rabbit polyclonal antibody against Mouse Ataxin 1 (ATXN1) |
![]() Ataxin-1 (phospho Ser776) Polyclonal Antibody |
|||
ABP56120-003ml | Abbkine | 0.03ml | EUR 158 |
Description: A polyclonal antibody for detection of Ataxin-1 phospho Ser776) from Human, Mouse. This Ataxin-1 phospho Ser776) antibody is for WB, IHC-P, IF, ELISA. It is affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogenand is unconjugated. The antibody is produced in rabbit by using as an immunogen synthesized peptide derived from human Ataxin-1 around the phosphorylation site of S776 |
![]() Ataxin-1 (phospho Ser776) Polyclonal Antibody |
|||
ABP56120-01ml | Abbkine | 0.1ml | EUR 289 |
Description: A polyclonal antibody for detection of Ataxin-1 phospho Ser776) from Human, Mouse. This Ataxin-1 phospho Ser776) antibody is for WB, IHC-P, IF, ELISA. It is affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogenand is unconjugated. The antibody is produced in rabbit by using as an immunogen synthesized peptide derived from human Ataxin-1 around the phosphorylation site of S776 |
![]() Ataxin-1 (phospho Ser776) Polyclonal Antibody |
|||
ABP56120-02ml | Abbkine | 0.2ml | EUR 414 |
Description: A polyclonal antibody for detection of Ataxin-1 phospho Ser776) from Human, Mouse. This Ataxin-1 phospho Ser776) antibody is for WB, IHC-P, IF, ELISA. It is affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogenand is unconjugated. The antibody is produced in rabbit by using as an immunogen synthesized peptide derived from human Ataxin-1 around the phosphorylation site of S776 |
![]() Ataxin 1 Like (ATXN1L) Antibody (HRP) |
|||
20-abx314758 | Abbexa |
|
|
![]() Ataxin 1 Like (ATXN1L) Antibody (FITC) |
|||
20-abx314759 | Abbexa |
|
|
![]() Ataxin 1 Like (ATXN1L) Antibody (Biotin) |
|||
20-abx314760 | Abbexa |
|
|
![]() Ataxin 1 (ATXN1) Antibody (ATTO 390) |
|||
abx440215-100ug | Abbexa | 100 ug | EUR 578 |
![]() Ataxin 1 (ATXN1) Antibody (ATTO 390) |
|||
abx440233-100ug | Abbexa | 100 ug | EUR 578 |
![]() Ataxin 1 (ATXN1) Antibody (ATTO 488) |
|||
abx440496-100ug | Abbexa | 100 ug | EUR 578 |
![]() Ataxin 1 (ATXN1) Antibody (ATTO 488) |
|||
abx440514-100ug | Abbexa | 100 ug | EUR 578 |
![]() Ataxin 1 (ATXN1) Antibody (ATTO 565) |
|||
abx440777-100ug | Abbexa | 100 ug | EUR 578 |
![]() Ataxin 1 (ATXN1) Antibody (ATTO 565) |
|||
abx440795-100ug | Abbexa | 100 ug | EUR 578 |
![]() Ataxin 1 (ATXN1) Antibody (ATTO 594) |
|||
abx441058-100ug | Abbexa | 100 ug | EUR 578 |
![]() Ataxin 1 (ATXN1) Antibody (ATTO 594) |
|||
abx441076-100ug | Abbexa | 100 ug | EUR 578 |
![]() Ataxin 1 (ATXN1) Antibody (ATTO 633) |
|||
abx441339-100ug | Abbexa | 100 ug | EUR 578 |
![]() Ataxin 1 (ATXN1) Antibody (ATTO 633) |
|||
abx441357-100ug | Abbexa | 100 ug | EUR 578 |
![]() Ataxin 1 (ATXN1) Antibody (ATTO 655) |
|||
abx441620-100ug | Abbexa | 100 ug | EUR 578 |
![]() Ataxin 1 (ATXN1) Antibody (ATTO 655) |
|||
abx441638-100ug | Abbexa | 100 ug | EUR 578 |
![]() Ataxin 1 (ATXN1) Antibody (ATTO 680) |
|||
abx441901-100ug | Abbexa | 100 ug | EUR 578 |
![]() Ataxin 1 (ATXN1) Antibody (ATTO 680) |
|||
abx441919-100ug | Abbexa | 100 ug | EUR 578 |
![]() Ataxin 1 (ATXN1) Antibody (ATTO 700) |
|||
abx442182-100ug | Abbexa | 100 ug | EUR 578 |
![]() Ataxin 1 (ATXN1) Antibody (ATTO 700) |
|||
abx442200-100ug | Abbexa | 100 ug | EUR 578 |
![]() Ataxin 7 Like 1 (ATXN7L1) Antibody |
|||
20-abx325156 | Abbexa |
|
|
![]() Ataxin-1 (phospho Ser776) Polyclonal Antibody |
|||
ES7119-100ul | ELK Biotech | 100ul | EUR 279 |
Description: A Rabbit Polyclonal antibody against Ataxin-1 (phospho Ser776) from Human/Mouse. This antibody is tested and validated for WB, ELISA, IHC, IF, WB, ELISA |
![]() Ataxin-1 (phospho Ser776) Polyclonal Antibody |
|||
ES7119-50ul | ELK Biotech | 50ul | EUR 207 |
Description: A Rabbit Polyclonal antibody against Ataxin-1 (phospho Ser776) from Human/Mouse. This antibody is tested and validated for WB, ELISA, IHC, IF, WB, ELISA |
![]() Anti-PARP-1 Antibody |
|||
A00122-1 | BosterBio | 100ul | EUR 397 |
Description: Rabbit Polyclonal PARP-1 Antibody. Validated in ELISA, IP, IF, WB and tested in Human, Mouse. |
![]() Anti-Presenilin 1 Antibody |
|||
A00138-1 | BosterBio | 100ul | EUR 397 |
Description: Rabbit Polyclonal Antibody for Presenilin 1 Antibody (PSEN1) detection. Tested with WB, IHC in Human, Mouse, Rat. |
![]() Anti-PAI-1 Antibody |
|||
A00637-1 | BosterBio | 100ul | EUR 397 |
Description: Rabbit Polyclonal Antibody for PAI-1 Antibody (SERPINE1) detection.tested for WB in Human, Mouse, Rat. |
![]() Anti-Flk-1 Antibody |
|||
A00901-1 | BosterBio | 100ul | EUR 397 |
Description: Rabbit Polyclonal Antibody for Flk-1 Antibody (KDR) detection.tested for WB in Human, Mouse. |
![]() Anti-EDG-1 Antibody |
|||
A01502-1 | BosterBio | 100ul | EUR 397 |
Description: Rabbit Polyclonal Antibody for EDG-1 Antibody (S1PR1) detection.tested for WB in Human, Mouse, Rat. |