Ophthalmic Manifestations and Genetics of the Polyglutamine Autosomal Dominant Spinocerebellar Ataxias: A Review

Ophthalmic Manifestations and Genetics of the Polyglutamine Autosomal Dominant Spinocerebellar Ataxias: A Review

Spinocerebellar ataxia (SCA) is part of the cerebellar neurodegenerative illness group that’s numerous in genetics and phenotypes. It often exhibits autosomal dominant inheritance. SCAs, at all times along with the cerebellar degeneration, could exhibit scientific deficits in brainstem or eye, particularly retina or optic nerve. Apparently, autosomal dominant SCAs share a typical genetic mechanism; the size of the glutamine chain is abnormally expanded because of the improve within the cytosine-adenine-guanine (CAG) repeats of the illness inflicting gene. Research have urged that the mutant ataxin induces alteration of protein conformation and irregular aggregation leading to nuclear inclusions, and causes mobile lack of photoreceptors by way of a poisonous impact.

In consequence, these pathologic modifications induce a downregulation of genes concerned within the phototransduction, growth, and differentiation of photoreceptors resembling CRX, one of many photoreceptor transcription components. Nonetheless, the precise mechanism of neuronal degeneration by mutant ataxin restricted to solely sure sort of neuronal cell together with cerebellar Purkinje neurons and photoreceptor continues to be unclear. The commonest SCAs are varieties 1, 2, 3, 6, 7, and 17 which comprise about 80% of autosomal dominant SCA instances. Numerous elements of eye motion abnormalities are evident relying on the diploma of cerebellar and brainstem degeneration in SCAs. As well as, sure varieties of SCAs resembling SCA7 are characterised by each cerebellar ataxia and visible loss primarily because of retinal degeneration.

The severity of the retinopathy can fluctuate from occult macular photoreceptor disruption to in depth retinal atrophy and is correlated with the variety of CAG repeats. The worth of utilizing optical coherence tomography along side electrodiagnostic and genetic testing is emphasised as the mix of those exams can present vital data concerning the etiology, morphological analysis, and purposeful significances. Due to this fact, ophthalmologists want to acknowledge and differentiate SCAs to be able to correctly diagnose and consider the illness. On this assessment, we’ve described and mentioned SCAs displaying ophthalmic abnormalities with explicit consideration to their ophthalmic options, neurodegenerative mechanisms, genetics, and future views.

The blood-brain barrier is disrupted in Machado-Joseph illness/spinocerebellar ataxia sort 3: proof from transgenic mice and human autopsy samples

Blood-brain barrier (BBB) disruption is a typical characteristic in neurodegenerative ailments. Nonetheless, BBB integrity has not been assessed in spinocerebellar ataxias resembling Machado-Joseph illness/SCA sort 3, a genetic dysfunction, triggered by polyglutamine-expanded ataxin-3. To analyze that, BBB integrity was evaluated in a transgenic mouse mannequin of MJD and in human autopsy mind tissues.Firstly, we investigated the BBB permeability in MJD mice by: i) assessing the extravasation of the Evans blue (EB) dye and blood-borne proteins (e.g fibrinogen) within the cerebellum by immunofluorescence, and ii) in vivo Dynamic Distinction Enhanced-Magnetic Resonance Imaging.
The presence of ataxin-Three aggregates in mind blood vessels and the degrees of tight junction (TJ)-associated proteins had been additionally explored by immunofluorescence and western blotting. Human mind samples had been used to verify BBB permeability by evaluating fibrinogen extravasation, co-localization of ataxin-Three aggregates with mind blood vessels and neuroinflammation.Within the cerebellum of the mouse mannequin of MJD, there was a 5-fold improve in EB accumulation when in comparison with age-matched controls. Furthermore, vascular permeability displayed a 13-fold improve demonstrated by DCE-MRI. These outcomes had been validated by the 2-fold improve in fibrinogen extravasation in transgenic animals evaluating to controls.
Apparently, mutant ataxin-Three aggregates had been detected in cerebellar blood vessels of transgenic mice, accompanied by alterations of TJ-associated proteins in cerebellar endothelial cells, particularly a 29% lower in claudin-5 oligomers and a 10-fold improve in an occludin cleavage fragment. These outcomes had been validated in autopsy mind samples from MJD sufferers as we detected fibrinogen extravasation throughout BBB, the presence of ataxin-Three aggregates in blood vessels and related microgliosis.Altogether, our outcomes show BBB impairment in MJD/SCA3. These findings contribute for a greater understanding of the illness mechanisms and opens the chance to deal with MJD with medicinal merchandise that in regular situations wouldn’t cross the BBB.
 Ophthalmic Manifestations and Genetics of the Polyglutamine Autosomal Dominant Spinocerebellar Ataxias: A Review

Ophthalmic Manifestations and Genetics of the Polyglutamine Autosomal Dominant Spinocerebellar Ataxias: A Review

Hypocretin/orexin loss modifications the hypothalamic immune response.

Hypocretin, also called orexin, maintains the vigilance state and regulates varied physiological processes, resembling arousal, sleep, meals consumption, vitality expenditure, and reward. Beforehand, we discovered that when wild-type mice and hypocretin/ataxin-Three littermates (that are depleted of hypothalamic hypocretin-expressing neurons postnatally) had been administered lipopolysaccharide (LPS), the 2 genotypes exhibited important variations of their sleep/wake cycle, together with variations within the diploma of improve in sleep durations and in restoration from illness behaviour.
Within the current examine, we examined modifications within the hypothalamic vigilance system and within the hypothalamic expression of inflammatory components in response to LPS in hypocretin/ataxin-Three mice. Peripheral immune problem with LPS affected the hypothalamic immune response and vigilance states. This response was altered by the lack of hypocretin. Hypocretin expression was inhibited after LPS injection in each hypocretin/ataxin-Three mice and their wild-type littermates, however expression was utterly abolished solely in hypocretin/ataxin-Three mice.

Ataxin 1 Antibody

AF6347-200ul 200ul
EUR 350

Ataxin 1 Antibody

ABF6347 100 ug
EUR 525.6

Ataxin-1 Antibody

E90506 100μg
EUR 255
Description: Available in various conjugation types.

Ataxin 1 Antibody / ATXN1

R32138 100 ug
EUR 356.15
Description: Ataxin-1 is a protein that in humans is encoded by the ATXN1 gene. The ATXN1 gene had been mapped to 6p23 by in situ hybridization. Ataxin-1 (ATXN1), a causative factor for spinocerebellar ataxia type 1 (SCA1), and the related Brother of ATXN1 (BOAT1) are human proteins involved in transcriptional repression. ATXN1 and BOAT1 might participate in several Notch-controlled developmental and pathological processes.

Ataxin-1 Polyclonal Antibody

40621-100ul 100ul
EUR 302.4

Ataxin-1 Polyclonal Antibody

40621-50ul 50ul
EUR 224.4

Ataxin-1 Polyclonal Antibody

E040621 100μg/100μl
EUR 255
Description: Available in various conjugation types.

Ataxin-1 Polyclonal Antibody

E20-70373 100ug
EUR 225
Description: Available in various conjugation types.

Ataxin-1 Polyclonal Antibody

ABP50719-003ml 0.03ml
EUR 189.6
Description: A polyclonal antibody for detection of Ataxin-1 from Human, Mouse. This Ataxin-1 antibody is for WB , IHC-P, IF, ELISA. It is affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogenand is unconjugated. The antibody is produced in rabbit by using as an immunogen synthesized peptide derived from human Ataxin-1 around the non-phosphorylation site of S776

Ataxin-1 Polyclonal Antibody

ABP50719-01ml 0.1ml
EUR 346.8
Description: A polyclonal antibody for detection of Ataxin-1 from Human, Mouse. This Ataxin-1 antibody is for WB , IHC-P, IF, ELISA. It is affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogenand is unconjugated. The antibody is produced in rabbit by using as an immunogen synthesized peptide derived from human Ataxin-1 around the non-phosphorylation site of S776

Ataxin-1 Polyclonal Antibody

ABP50719-02ml 0.2ml
EUR 496.8
Description: A polyclonal antibody for detection of Ataxin-1 from Human, Mouse. This Ataxin-1 antibody is for WB , IHC-P, IF, ELISA. It is affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogenand is unconjugated. The antibody is produced in rabbit by using as an immunogen synthesized peptide derived from human Ataxin-1 around the non-phosphorylation site of S776

Ataxin-1 Polyclonal Antibody

E44H01617 100ul
EUR 255
Description: Biotin-Conjugated, FITC-Conjugated , AF350 Conjugated , AF405M-Conjugated ,AF488-Conjugated, AF514-Conjugated ,AF532-Conjugated, AF555-Conjugated ,AF568-Conjugated , HRP-Conjugated, AF405S-Conjugated, AF405L-Conjugated , AF546-Conjugated, AF594-Conjugated , AF610-Conjugated, AF635-Conjugated , AF647-Conjugated , AF680-Conjugated , AF700-Conjugated , AF750-Conjugated , AF790-Conjugated , APC-Conjugated , PE-Conjugated , Cy3-Conjugated , Cy5-Conjugated , Cy5.5-Conjugated , Cy7-Conjugated Antibody

Ataxin 3 antibody

22437 100ul
EUR 479

Ataxin 3 antibody

22437-100ul 100ul
EUR 468

Ataxin 2 Antibody

E38PA2046 100ul
EUR 225
Description: Available in various conjugation types.

Ataxin 10 Antibody

E38PA2595 100ul
EUR 225
Description: Available in various conjugation types.

Ataxin 3 Antibody

DF6375 200ul
EUR 420

Ataxin 3 Antibody

DF6375-100ul 100ul
EUR 280

Ataxin 3 Antibody

DF6375-200ul 200ul
EUR 350

Ataxin 3 Antibody

E300595 100ug/200ul
EUR 275
Description: Available in various conjugation types.

Ataxin 7 Antibody

E300596 100ug/200ul
EUR 275
Description: Available in various conjugation types.

Ataxin 3 antibody

70R-13630 100 ul
EUR 548
Description: Affinity purified Rabbit polyclonal Ataxin 3 antibody

Ataxin 2 antibody

70R-50365 100 ul
EUR 242
Description: Purified Polyclonal Ataxin 2 antibody

Ataxin 10 antibody

70R-50914 100 ul
EUR 242
Description: Purified Polyclonal Ataxin 10 antibody

Ataxin 1 (pS775) Antibody

E38PA4341 100ul
EUR 225
Description: Available in various conjugation types.

Ataxin 1 (ATXN1) Antibody

20-abx325351
  • Ask for price
  • Ask for price
  • 100 ug
  • 50 ug

Ataxin 1 (ATXN1) Antibody

abx432383-200ul 200 ul
EUR 343.2

Ataxin 1 (ATXN1) Antibody

abx431572-200ul 200 ul
EUR 343.2

Ataxin 1 (ATXN1) Antibody

20-abx320078
  • Ask for price
  • Ask for price
  • 100 ul
  • 50 ul

Ataxin 1 (ATXN1) Antibody

abx445066-100ug 100 ug
EUR 627.6

Ataxin 1 (ATXN1) Antibody

abx445084-100ug 100 ug
EUR 627.6

Ataxin 1 (ATXN1) Antibody

20-abx100304
  • Ask for price
  • Ask for price
  • Ask for price
  • Ask for price
  • Ask for price
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug

Ataxin 1 (ATXN1) Antibody

20-abx129635
  • Ask for price
  • Ask for price
  • Ask for price
  • Ask for price
  • Ask for price
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug

Ataxin 1 (ATXN1) Antibody

20-abx171342
  • Ask for price
  • Ask for price
  • 1 mg
  • 200 ug

Ataxin 1 (ATXN1) Antibody

20-abx214569
  • Ask for price
  • Ask for price
  • 100 ul
  • 50 ul

Ataxin 1 (ATXN1) Antibody

20-abx126836
  • Ask for price
  • Ask for price
  • 100 ul
  • 200 ul

Ataxin 1 (ATXN1) Antibody

20-abx242069
  • Ask for price
  • Ask for price
  • 100 ul
  • 50 ul

Ataxin 1 (ATXN1) Antibody

abx145346-100ug 100 ug
EUR 469.2

Ataxin 1 (pS775) Antibody

20-abx121842
  • Ask for price
  • Ask for price
  • Ask for price
  • 100 ul
  • 200 ul
  • 30 ul

Ataxin 1 (ATXN1) Antibody

20-abx133167
  • Ask for price
  • Ask for price
  • Ask for price
  • 100 ul
  • 200 ul
  • 30 ul

Ataxin 1 (ATXN1) Antibody

20-abx004749
  • Ask for price
  • Ask for price
  • Ask for price
  • Ask for price
  • 100 ul
  • 200 ul
  • 20 ul
  • 50 ul

Ataxin 1 (pS776) Antibody

abx010423-100ug 100 ug
EUR 526.8

Ataxin 1 (ATXN1) Antibody

abx010425-100ul 100 ul
EUR 493.2

Ataxin 1 (ATXN1) Antibody

abx031721-400ul 400 ul
EUR 627.6

Ataxin 1 (ATXN1) Antibody

abx031721-80l 80 µl
EUR 343.2

Ataxin 1 (ATXN1) Antibody

abx004749-100l 100 µl
EUR 400

Ataxin 1 (ATXN1) Antibody

abx004749-20l 20 µl
EUR 175

Ataxin 1 (ATXN1) Antibody

abx004749-50l 50 µl
EUR 275

Ataxin 1 (ATXN1) Antibody

abx010425-100g 100 µg Ask for price

Ataxin 1 (ATXN1) Antibody

abx010425-10g 10 µg
EUR 362.5

Ataxin 1 (ATXN1) Antibody

abx010425-200g 200 µg Ask for price

Ataxin 1 (ATXN1) Antibody

abx242069-96tests 96 tests
EUR 250

Ataxin 1 (ATXN1) Antibody

abx129635-100l 100 µl
EUR 262.5

Ataxin 1 (ATXN1) Antibody

abx129635-1ml 1 ml
EUR 687.5

Ataxin 1 (ATXN1) Antibody

abx129635-200l 200 µl
EUR 325

Ataxin 1 (ATXN1) Antibody

abx145346-1096tests 10 × 96 tests Ask for price

Ataxin 1 (ATXN1) Antibody

abx145346-596tests 5 × 96 tests Ask for price

Ataxin 1 (ATXN1) Antibody

abx145346-96tests 96 tests
EUR 337.5

Ataxin 1 (ATXN1) Antibody

abx100304-100l 100 µl
EUR 250

Ataxin 1 (ATXN1) Antibody

abx100304-1ml 1 ml
EUR 675

Ataxin 1 (ATXN1) Antibody

abx100304-200l 200 µl
EUR 312.5

Ataxin 1 (ATXN1) Antibody

abx031721-400l 400 µl
EUR 518.75

Ataxin 1 (ATXN1) Antibody

abx171342-1ml 1 ml
EUR 712.5

Ataxin 1 (ATXN1) Antibody

abx214569-100tests 100 tests
EUR 350

Ataxin 1 (ATXN1) Antibody

abx214569-200tests 200 tests Ask for price

Ataxin 1 (ATXN1) Antibody

abx214569-20tests 20 tests
EUR 250

Ataxin 1 (ATXN1) Antibody

abx320078-100l 100 µl
EUR 350

Ataxin 1 (ATXN1) Antibody

abx320078-50l 50 µl
EUR 237.5

Ataxin 1 (ATXN1) Antibody

abx325351-100g 100 µg
EUR 250

Ataxin 1 (ATXN1) Antibody

abx325351-50g 50 µg
EUR 187.5

Ataxin 1 (ATXN1) Antibody

abx431572-200l 200 µl
EUR 250

Ataxin 1 (ATXN1) Antibody

abx432383-100g 100 µg
EUR 250

Ataxin 1 (ATXN1) Antibody

abx445066-100g 100 µg
EUR 550

Ataxin 1 (ATXN1) Antibody

abx445084-100g 100 µg
EUR 550

Ataxin-2 Antibody

R31210 100 ug
EUR 356.15
Description: Ataxin-2, the protein encoded by the ATXN2 gene, contains a polyglutamine tract, long expansions (greater than 33 repeats) of which result in spinocerebellar ataxia-2 (SCA2), an autosomal dominant form of olivopontocerebellar atrophy. The gene for spinocerebellar ataxia type 2(SCA2) has been mapped to 12q24.1. Ataxin-2 associates with L- and T-plastin and overexpression leads to accumulation of T-plastin in mammalian cells.

Rabbit Polyclonal Ataxin 1 Antibody

TA325245 100 µl Ask for price

OASE00303-100UG - Ataxin 1 Antibody

OASE00303-100UG 100ug
EUR 429

OASE00321-100UG - Ataxin 1 Antibody

OASE00321-100UG 100ug
EUR 429

Ataxin 1 Antibody, Clone S76-8

SMC-455D 0.1mg
EUR 330
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical). . The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is not conjugated.

Ataxin 1 Antibody, Clone S76-8

SMC-455S 0.012mg
EUR 44
Description: A monoclonal antibody from clone S76-8 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical). . The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is not conjugated.

Ataxin 1 Antibody, Clone S65-37

SMC-475D 0.1mg
EUR 330
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical). . The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is not conjugated.

Ataxin 1 Antibody, Clone S65-37

SMC-475S 0.012mg
EUR 44
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical). . The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is not conjugated.

Ataxin 1 (Ab-776) Antibody

8B0771 50ug
EUR 368
Description: Ataxin 1 (Ab-776) Antibody

Ataxin 1 (ATXN1) Antibody (PE)

abx444428-100g 100 µg
EUR 600

Ataxin 1 (ATXN1) Antibody (PE)

abx444446-100g 100 µg
EUR 600

Ataxin 1 (ATXN1) Antibody (ALP)

abx442463-100ug 100 ug
EUR 693.6

Ataxin 1 (ATXN1) Antibody (ALP)

abx442481-100ug 100 ug
EUR 693.6

Ataxin 1 (ATXN1) Antibody (APC)

abx442744-100ug 100 ug
EUR 693.6

Ataxin 1 (ATXN1) Antibody (APC)

abx442762-100ug 100 ug
EUR 693.6

Ataxin 1 (ATXN1) Antibody (HRP)

abx443585-100ug 100 ug
EUR 678

Ataxin 1 (ATXN1) Antibody (HRP)

abx443603-100ug 100 ug
EUR 678

Ataxin 1 (ATXN1) Antibody (RPE)

abx444428-100ug 100 ug
EUR 693.6

Ataxin 1 (ATXN1) Antibody (RPE)

abx444446-100ug 100 ug
EUR 693.6

Ataxin 1 (ATXN1) Antibody (APC)

abx442744-200g 200 µg
EUR 612.5

Ataxin 1 (ATXN1) Antibody (APC)

abx442762-100l 100 µl
EUR 612.5

Ataxin 1 (ATXN1) Antibody (HRP)

abx443585-100g 100 µg
EUR 600

Ataxin 1 (ATXN1) Antibody (HRP)

abx443603-100g 100 µg
EUR 600

Rabbit Polyclonal antibody to Ataxin 3 (ataxin 3)

TA308320 100 µl Ask for price

Ataxin 3 Antibody / ATXN3

F55027-0.08ML 0.08 ml
EUR 140.25
Description: ATXN3 was known as spinocerebellar ataxia-3, is an autosomal dominant neurologic disorder. The protein contains (CAG)n repeats in the coding region, and the expansion of these repeats from the normal 13-36 to 68-79 is one cause of Machado-Joseph disease. There is a negative correlation between the age of onset and CAG repeat numbers.

Ataxin 3 Antibody / ATXN3

F55027-0.4ML 0.4 ml
EUR 322.15
Description: ATXN3 was known as spinocerebellar ataxia-3, is an autosomal dominant neurologic disorder. The protein contains (CAG)n repeats in the coding region, and the expansion of these repeats from the normal 13-36 to 68-79 is one cause of Machado-Joseph disease. There is a negative correlation between the age of onset and CAG repeat numbers.

Ataxin 3 Antibody / ATXN3

R32137 100 ug
EUR 356.15
Description: ATXN3 (Ataxin 3), also known as AT3, MJD GENE, MJD1, SCA3 GENE, ATX3, JOS, Spinocerebellar ataxia-3, Machado-Joseph disease protein 1, is a protein that in humans is encoded by the ATXN3 gene. ATXN3 ranges in size from 360 to 374 amino acids. Using Northern blot analysis showed that ATXN3 mRNA was ubiquitously expressed in human tissues. They detected at least 4 ATXN3 transcripts of 1.4, 1.8, 4.5, and 7.5 kb and suggested that the different mRNA species probably result from differential splicing and polyadenylation. Machado-Joseph disease, also known as spinocerebellar ataxia-3, is an autosomal dominant neurologic disorder. The protein encoded by the ATXN3 gene contains (CAG)n repeats in the coding region, and the expansion of these repeats from the normal 13-36 to 68-79 is the cause of Machado-Joseph disease. There is an inverse correlation between the age of onset and CAG repeat numbers. Alternatively spliced transcript variants encoding different isoforms have been described for this gene. Ataxin-3 interacted with 2 human homologs of the yeast DNA repair protein RAD23, HHR23A (RAD23A) and HHR23B (RAD23B). Both normal and mutant ataxin-3 proteins interacted with the ubiquitin-like domain at the N terminus of the HHR23 proteins, which is a motif important for nucleotide excision repair. However, in HEK 293 cells, HHR23A was recruited to intranuclear inclusions formed by the mutant ataxin-3 through its interaction with ataxin-3.

Ataxin 1 (ATXN1) Antibody (FITC)

abx443304-100ug 100 ug
EUR 678

Ataxin 1 (ATXN1) Antibody (FITC)

abx443322-100ug 100 ug
EUR 678

Ataxin 1 (ATXN1) Antibody (FITC)

abx443304-100g 100 µg
EUR 600

Ataxin 1 (ATXN1) Antibody (FITC)

abx443322-100g 100 µg
EUR 600

Ataxin-1 Rabbit Polyclonal Antibody

ES1718-100ul 100ul
EUR 124
Description: A Rabbit Polyclonal antibody against Ataxin-1 from Human/Mouse. This antibody is tested and validated for WB, ELISA, IHC, IF, WB, ELISA

Ataxin-1 Rabbit Polyclonal Antibody

ES1718-50ul 50ul
EUR 74
Description: A Rabbit Polyclonal antibody against Ataxin-1 from Human/Mouse. This antibody is tested and validated for WB, ELISA, IHC, IF, WB, ELISA

Ataxin 1 (ATXN1) Antibody (PerCP)

abx444147-100ug 100 ug
EUR 693.6

Ataxin 1 (ATXN1) Antibody (PerCP)

abx444165-100ug 100 ug
EUR 693.6

Ataxin 1 Like (ATXN1L) Antibody

20-abx301794
  • Ask for price
  • Ask for price
  • Ask for price
  • Ask for price
  • Ask for price
  • 100 ug
  • 1 mg
  • 200 ug
  • 20 ug
  • 50 ug

Ataxin 1 Like (ATXN1L) Antibody

abx030547-400ul 400 ul
EUR 627.6

Ataxin 1 Like (ATXN1L) Antibody

abx030547-80l 80 µl
EUR 343.2

Ataxin 1 Like (ATXN1L) Antibody

abx301794-100g 100 µg
EUR 362.5

Ataxin 1 Like (ATXN1L) Antibody

abx301794-20g 20 µg
EUR 162.5

Ataxin 1 Like (ATXN1L) Antibody

abx301794-50g 50 µg
EUR 250

Ataxin 1 Like (ATXN1L) Antibody

abx030547-400l 400 µl
EUR 518.75

Ataxin 1 (ATXN1) Antibody (PerCP)

abx444147-100g 100 µg
EUR 612.5

Ataxin 1 (ATXN1) Antibody (PerCP)

abx444165-100g 100 µg
EUR 612.5

Ataxin 1 Antibody, Clone S76-8: APC

SMC-455D-APC 0.1mg
EUR 382
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical). . The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with APC.

Ataxin 1 Antibody, Clone S76-8: HRP

SMC-455D-HRP 0.1mg
EUR 370
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical). . The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with HRP.

Ataxin 1 Antibody, Clone S76-8: RPE

SMC-455D-RPE 0.1mg
EUR 380
Description: A monoclonal antibody from clone S76-8 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical). . The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with RPE.

Ataxin-2 Antibody / ATXN2

R32313 100 ug
EUR 356.15
Description: Ataxin-2, or ATX2, protein is encoded by the ATXN2 gene and contains a polyglutamine tract, long expansions (greater than 33 repeats) of which result in spinocerebellar ataxia-2 (SCA2), an autosomal dominant form of olivopontocerebellar atrophy. The gene for spinocerebellar ataxia type 2 (SCA2) has been mapped to 12q24.1. Ataxin-2 associates with L- and T-plastin and that overexpression of ataxin-2 leads to accumulation of T-plastin in mammalian cells.

Ataxin 1 (ATXN1) Antibody (Biotin)

abx443024-100ug 100 ug
EUR 693.6

Ataxin 1 (ATXN1) Antibody (Biotin)

abx443042-100ug 100 ug
EUR 693.6

Ataxin 1 (ATXN1) Antibody (Biotin)

abx443024-100l 100 µl
EUR 600

Ataxin 1 (ATXN1) Antibody (Biotin)

abx443042-400l 400 µl
EUR 600

Ataxin 1 Antibody, Clone S76-8: FITC

SMC-455D-FITC 0.1mg
EUR 374
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical). . The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with FITC.

Ataxin 1 Antibody, Clone S65-37: APC

SMC-475D-APC 0.1mg
EUR 382
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical). . The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with APC.

Ataxin 1 Antibody, Clone S65-37: HRP

SMC-475D-HRP 0.1mg
EUR 370
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical). . The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with HRP.

Ataxin 1 Antibody, Clone S65-37: RPE

SMC-475D-RPE 0.1mg
EUR 380
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical). . The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with RPE.

Ataxin 1 (ATXN1) Antibody (ATTO488)

abx440496-100g 100 µg
EUR 612.5

Ataxin 1 (ATXN1) Antibody (ATTO488)

abx440514-100g 100 µg
EUR 612.5

Ataxin 1 (ATXN1) Antibody (ATTO594)

abx441058-100g 100 µg
EUR 612.5

Ataxin 1 (ATXN1) Antibody (ATTO594)

abx441076-100g 100 µg
EUR 612.5

Ataxin 1 (ATXN1) Antibody (ATTO390)

abx440215-100g 100 µg
EUR 612.5

Ataxin 1 (ATXN1) Antibody (ATTO390)

abx440233-100g 100 µg
EUR 612.5

Ataxin 1 Antibody, Clone S76-8: PerCP

SMC-455D-PCP 0.1mg
EUR 382
Description: A monoclonal antibody from clone S76-8 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical). . The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with PerCP.

Ataxin 1 Antibody, Clone S65-37: FITC

SMC-475D-FITC 0.1mg
EUR 374
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical). . The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with FITC.

Polyclonal Ataxin 10 Antibody

APG03169G 0.1ml
EUR 580.8
Description: A polyclonal antibody raised in Rabbit that recognizes and binds to Human Ataxin 10 . This antibody is tested and proven to work in the following applications:

Polyclonal Ataxin 2 Antibody

APG03170G 0.1ml
EUR 580.8
Description: A polyclonal antibody raised in Rabbit that recognizes and binds to Human Ataxin 2 . This antibody is tested and proven to work in the following applications:

Ataxin 1 Antibody, Clone S76-8: Biotin

SMC-455D-BI 0.1mg
EUR 378
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical). . The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with Biotin.

Ataxin 1 Antibody, Clone S65-37: PerCP

SMC-475D-PCP 0.1mg
EUR 382
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical). . The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with PerCP.

Ataxin-1 Polyclonal Conjugated Antibody

C40621 100ul
EUR 476.4

Phospho- Ataxin 1 (Ser775) Antibody

ABF3347 100 ug
EUR 525.6

Monoclonal antibody for Ataxin 1

SMC-455D-A565 0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical). . The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with ATTO 565.

Monoclonal antibody for Ataxin 1

SMC-455D-A633 0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical). . The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with ATTO 633.

Monoclonal antibody for Ataxin 1

SMC-455D-A655 0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical). . The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with ATTO 655.

Monoclonal antibody for Ataxin 1

SMC-455D-A680 0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical). . The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with ATTO 680.

Monoclonal antibody for Ataxin 1

SMC-455D-A700 0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical). . The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with ATTO 700.

Monoclonal antibody for Ataxin 1

SMC-455D-APCCY7 0.1mg
EUR 564
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical). . The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with APC/Cy7.

Monoclonal antibody for Ataxin 1

SMC-455D-DY350 0.1mg
EUR 495.6
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical). . The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with Dylight 350.

Monoclonal antibody for Ataxin 1

SMC-455D-DY405 0.1mg
EUR 482.4
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical). . The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with Dylight 405.

Monoclonal antibody for Ataxin 1

SMC-455D-DY488 0.1mg
EUR 470.4
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical). . The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with Dylight 488.

Monoclonal antibody for Ataxin 1

SMC-455D-DY594 0.1mg
EUR 472.8
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical). . The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with Dylight 594.
Will increase within the variety of histidine decarboxylase (HDC)-positive cells and in Hdc mRNA expression had been present in hypocretin/ataxin-Three mice, and this improve was suppressed by LPS. Hypocretin loss didn’t affect the change in expression of hypothalamic inflammatory components in response to LPS, apart from interferon gamma and colony stimulating issue 3.

Leave a Reply

Your email address will not be published.