Ophthalmic Manifestations and Genetics of the Polyglutamine Autosomal Dominant Spinocerebellar Ataxias: A Review

Ophthalmic Manifestations and Genetics of the Polyglutamine Autosomal Dominant Spinocerebellar Ataxias: A Review

Spinocerebellar ataxia (SCA) is part of the cerebellar neurodegenerative illness group that’s numerous in genetics and phenotypes. It often exhibits autosomal dominant inheritance. SCAs, at all times along with the cerebellar degeneration, could exhibit scientific deficits in brainstem or eye, particularly retina or optic nerve. Apparently, autosomal dominant SCAs share a typical genetic mechanism; the size of the glutamine chain is abnormally expanded because of the improve within the cytosine-adenine-guanine (CAG) repeats of the illness inflicting gene. Research have urged that the mutant ataxin induces alteration of protein conformation and irregular aggregation leading to nuclear inclusions, and causes mobile lack of photoreceptors by way of a poisonous impact.

In consequence, these pathologic modifications induce a downregulation of genes concerned within the phototransduction, growth, and differentiation of photoreceptors resembling CRX, one of many photoreceptor transcription components. Nonetheless, the precise mechanism of neuronal degeneration by mutant ataxin restricted to solely sure sort of neuronal cell together with cerebellar Purkinje neurons and photoreceptor continues to be unclear. The commonest SCAs are varieties 1, 2, 3, 6, 7, and 17 which comprise about 80% of autosomal dominant SCA instances. Numerous elements of eye motion abnormalities are evident relying on the diploma of cerebellar and brainstem degeneration in SCAs. As well as, sure varieties of SCAs resembling SCA7 are characterised by each cerebellar ataxia and visible loss primarily because of retinal degeneration.

The severity of the retinopathy can fluctuate from occult macular photoreceptor disruption to in depth retinal atrophy and is correlated with the variety of CAG repeats. The worth of utilizing optical coherence tomography along side electrodiagnostic and genetic testing is emphasised as the mix of those exams can present vital data concerning the etiology, morphological analysis, and purposeful significances. Due to this fact, ophthalmologists want to acknowledge and differentiate SCAs to be able to correctly diagnose and consider the illness. On this assessment, we’ve described and mentioned SCAs displaying ophthalmic abnormalities with explicit consideration to their ophthalmic options, neurodegenerative mechanisms, genetics, and future views.

The blood-brain barrier is disrupted in Machado-Joseph illness/spinocerebellar ataxia sort 3: proof from transgenic mice and human autopsy samples

Blood-brain barrier (BBB) disruption is a typical characteristic in neurodegenerative ailments. Nonetheless, BBB integrity has not been assessed in spinocerebellar ataxias resembling Machado-Joseph illness/SCA sort 3, a genetic dysfunction, triggered by polyglutamine-expanded ataxin-3. To analyze that, BBB integrity was evaluated in a transgenic mouse mannequin of MJD and in human autopsy mind tissues.Firstly, we investigated the BBB permeability in MJD mice by: i) assessing the extravasation of the Evans blue (EB) dye and blood-borne proteins (e.g fibrinogen) within the cerebellum by immunofluorescence, and ii) in vivo Dynamic Distinction Enhanced-Magnetic Resonance Imaging.
The presence of ataxin-Three aggregates in mind blood vessels and the degrees of tight junction (TJ)-associated proteins had been additionally explored by immunofluorescence and western blotting. Human mind samples had been used to verify BBB permeability by evaluating fibrinogen extravasation, co-localization of ataxin-Three aggregates with mind blood vessels and neuroinflammation.Within the cerebellum of the mouse mannequin of MJD, there was a 5-fold improve in EB accumulation when in comparison with age-matched controls. Furthermore, vascular permeability displayed a 13-fold improve demonstrated by DCE-MRI. These outcomes had been validated by the 2-fold improve in fibrinogen extravasation in transgenic animals evaluating to controls.
Apparently, mutant ataxin-Three aggregates had been detected in cerebellar blood vessels of transgenic mice, accompanied by alterations of TJ-associated proteins in cerebellar endothelial cells, particularly a 29% lower in claudin-5 oligomers and a 10-fold improve in an occludin cleavage fragment. These outcomes had been validated in autopsy mind samples from MJD sufferers as we detected fibrinogen extravasation throughout BBB, the presence of ataxin-Three aggregates in blood vessels and related microgliosis.Altogether, our outcomes show BBB impairment in MJD/SCA3. These findings contribute for a greater understanding of the illness mechanisms and opens the chance to deal with MJD with medicinal merchandise that in regular situations wouldn’t cross the BBB.
 Ophthalmic Manifestations and Genetics of the Polyglutamine Autosomal Dominant Spinocerebellar Ataxias: A Review

Ophthalmic Manifestations and Genetics of the Polyglutamine Autosomal Dominant Spinocerebellar Ataxias: A Review

Hypocretin/orexin loss modifications the hypothalamic immune response.

Hypocretin, also called orexin, maintains the vigilance state and regulates varied physiological processes, resembling arousal, sleep, meals consumption, vitality expenditure, and reward. Beforehand, we discovered that when wild-type mice and hypocretin/ataxin-Three littermates (that are depleted of hypothalamic hypocretin-expressing neurons postnatally) had been administered lipopolysaccharide (LPS), the 2 genotypes exhibited important variations of their sleep/wake cycle, together with variations within the diploma of improve in sleep durations and in restoration from illness behaviour.
Within the current examine, we examined modifications within the hypothalamic vigilance system and within the hypothalamic expression of inflammatory components in response to LPS in hypocretin/ataxin-Three mice. Peripheral immune problem with LPS affected the hypothalamic immune response and vigilance states. This response was altered by the lack of hypocretin. Hypocretin expression was inhibited after LPS injection in each hypocretin/ataxin-Three mice and their wild-type littermates, however expression was utterly abolished solely in hypocretin/ataxin-Three mice.

Anti-Ataxin 1 (4C5)

YF-MA15341 100 ug
EUR 435.6
Description: Mouse monoclonal to Ataxin 1

HRP-Goat Anti-Mouse Secondary Antibody

  • EUR 232.26
  • EUR 117.70
  • 350 µg
  • 350 ug

HRP-Goat Anti-Rabbit Secondary Antibody

  • EUR 232.26
  • EUR 117.70
  • 350 µg
  • 350 ug

Goat Anti-Rabbit Secondary Antibody, Biotin Conjugated

  • EUR 232.26
  • EUR 117.70
  • 350 µg
  • 350 ug

Goat Anti-Rat Secondary Antibody, Biotin Conjugated

  • EUR 232.26
  • EUR 117.70
  • 350 µg
  • 350 ug

Ataxin 1 Antibody

ABF6347 100 ug
EUR 525.6

Ataxin 1 Antibody

AF6347 200ul
EUR 420

Anti-Phospho-Ataxin-1 (S776) antibody

STJ90696 200 µl
EUR 236.4
Description: Rabbit polyclonal to Phospho-Ataxin-1 (S776).

Anti-Ataxin-2L Antibody

A08149 100ul
EUR 476.4
Description: Rabbit Polyclonal Antibody for Ataxin-2L Antibody (ATXN2L) detection. Tested with WB in Human.

Anti-Ataxin 2 antibody

PAab00657 100 ug
EUR 426

anti- Ataxin 2 antibody

FNab00657 100µg
EUR 606.3
Description: Antibody raised against Ataxin 2

Anti-Ataxin-2 antibody

STJ91739 200 µl
EUR 236.4
Description: Rabbit polyclonal to Ataxin-2.

Anti-Ataxin-2L antibody

STJ91740 200 µl
EUR 236.4
Description: Rabbit polyclonal to Ataxin-2L.

Anti-Ataxin-7L1 antibody

STJ91741 200 µl
EUR 236.4
Description: Rabbit polyclonal to Ataxin-7L1.

Ataxin-1 Polyclonal Antibody

40621-100ul 100ul
EUR 302.4

Ataxin-1 Polyclonal Antibody

40621-50ul 50ul
EUR 224.4

Ataxin 1 (ATXN1) Antibody

  • EUR 944.40
  • EUR 493.20
  • 1 mg
  • 200 ug

Ataxin 1 (ATXN1) Antibody

  • EUR 360.00
  • EUR 526.80
  • EUR 226.80
  • 100 ul
  • 200 ul
  • 30 ul

Ataxin 1 (ATXN1) Antibody

abx145346-100ug 100 ug
EUR 469.2

Ataxin-1 Polyclonal Antibody

ABP50719-003ml 0.03ml
EUR 189.6
Description: A polyclonal antibody for detection of Ataxin-1 from Human, Mouse. This Ataxin-1 antibody is for WB , IHC-P, IF, ELISA. It is affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogenand is unconjugated. The antibody is produced in rabbit by using as an immunogen synthesized peptide derived from human Ataxin-1 around the non-phosphorylation site of S776

Ataxin-1 Polyclonal Antibody

ABP50719-01ml 0.1ml
EUR 346.8
Description: A polyclonal antibody for detection of Ataxin-1 from Human, Mouse. This Ataxin-1 antibody is for WB , IHC-P, IF, ELISA. It is affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogenand is unconjugated. The antibody is produced in rabbit by using as an immunogen synthesized peptide derived from human Ataxin-1 around the non-phosphorylation site of S776

Ataxin-1 Polyclonal Antibody

ABP50719-02ml 0.2ml
EUR 496.8
Description: A polyclonal antibody for detection of Ataxin-1 from Human, Mouse. This Ataxin-1 antibody is for WB , IHC-P, IF, ELISA. It is affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogenand is unconjugated. The antibody is produced in rabbit by using as an immunogen synthesized peptide derived from human Ataxin-1 around the non-phosphorylation site of S776

Ataxin 1 (ATXN1) Antibody

  • EUR 477.60
  • EUR 159.60
  • EUR 1328.40
  • EUR 644.40
  • EUR 376.80
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug

Ataxin 1 (ATXN1) Antibody

  • EUR 493.20
  • EUR 710.40
  • EUR 218.40
  • EUR 376.80
  • 100 ul
  • 200 ul
  • 20 ul
  • 50 ul

Ataxin 1 (pS775) Antibody

  • EUR 376.80
  • EUR 560.40
  • EUR 243.60
  • 100 ul
  • 200 ul
  • 30 ul

Ataxin 1 (ATXN1) Antibody

  • EUR 493.20
  • EUR 710.40
  • 100 ul
  • 200 ul

Ataxin 1 (ATXN1) Antibody

  • EUR 493.20
  • EUR 159.60
  • EUR 1362.00
  • EUR 661.20
  • EUR 376.80
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug

Ataxin 1 (pS776) Antibody

abx010423-100ug 100 ug
EUR 526.8

Ataxin 1 (ATXN1) Antibody

abx010425-100ul 100 ul
EUR 493.2

Ataxin 1 (ATXN1) Antibody

abx031721-400ul 400 ul
EUR 627.6

Ataxin 1 (ATXN1) Antibody

abx031721-80l 80 µl
EUR 343.2

Ataxin 1 (ATXN1) Antibody

  • EUR 360.00
  • EUR 292.80
  • 100 ul
  • 50 ul

Ataxin 1 (ATXN1) Antibody

  • EUR 493.20
  • EUR 360.00
  • 100 ul
  • 50 ul

Ataxin 1 (ATXN1) Antibody

  • EUR 376.80
  • EUR 292.80
  • 100 ug
  • 50 ug

Ataxin 1 (ATXN1) Antibody

abx431572-200ul 200 ul
EUR 343.2

Ataxin 1 (ATXN1) Antibody

abx432383-200ul 200 ul
EUR 343.2

Ataxin 1 (ATXN1) Antibody

abx445066-100ug 100 ug
EUR 627.6

Ataxin 1 (ATXN1) Antibody

abx445084-100ug 100 ug
EUR 627.6

Ataxin 1 (ATXN1) Antibody

  • EUR 493.20
  • EUR 360.00
  • 100 ul
  • 50 ul

Ataxin-1 Polyclonal Antibody

ES1718-100ul 100ul
EUR 334.8
Description: A Rabbit Polyclonal antibody against Ataxin-1 from Human/Mouse. This antibody is tested and validated for WB, ELISA, IHC, IF, WB, ELISA

Ataxin-1 Polyclonal Antibody

ES1718-50ul 50ul
EUR 248.4
Description: A Rabbit Polyclonal antibody against Ataxin-1 from Human/Mouse. This antibody is tested and validated for WB, ELISA, IHC, IF, WB, ELISA

Ataxin 1 Antibody / ATXN1

R32138 100 ug
EUR 419

Anti-Ataxin 3/ATXN3 Antibody

PA1846 100ug/vial
EUR 400.8

Anti-Ataxin 3/ATXN3 Antibody

PB9423 100ug/vial
EUR 400.8

Ataxin 1 (Phospho-Ser776) Antibody

12034-100ul 100ul
EUR 302.4

Ataxin 1 (Phospho-Ser776) Antibody

12034-50ul 50ul
EUR 224.4

Ataxin 1 Like (ATXN1L) Antibody

abx030547-400ul 400 ul
EUR 627.6

Ataxin 1 Like (ATXN1L) Antibody

abx030547-80l 80 µl
EUR 343.2

Phospho- Ataxin 1 (Ser775) Antibody

ABF3347 100 ug
EUR 525.6

Ataxin 1 Like (ATXN1L) Antibody

  • EUR 493.20
  • EUR 2214.00
  • EUR 718.80
  • EUR 218.40
  • EUR 360.00
  • 100 ug
  • 1 mg
  • 200 ug
  • 20 ug
  • 50 ug

Ataxin 1 (ATXN1) Antibody (ALP)

abx442463-100ug 100 ug
EUR 693.6

Ataxin 1 (ATXN1) Antibody (ALP)

abx442481-100ug 100 ug
EUR 693.6

Ataxin 1 (ATXN1) Antibody (APC)

abx442744-100ug 100 ug
EUR 693.6

Ataxin 1 (ATXN1) Antibody (APC)

abx442762-100ug 100 ug
EUR 693.6

Ataxin 1 (ATXN1) Antibody (Biotin)

abx443024-100ug 100 ug
EUR 693.6

Ataxin 1 (ATXN1) Antibody (Biotin)

abx443042-100ug 100 ug
EUR 693.6

Ataxin 1 (ATXN1) Antibody (FITC)

abx443304-100ug 100 ug
EUR 678

Ataxin 1 (ATXN1) Antibody (FITC)

abx443322-100ug 100 ug
EUR 678

Ataxin 1 (ATXN1) Antibody (HRP)

abx443585-100ug 100 ug
EUR 678

Ataxin 1 (ATXN1) Antibody (HRP)

abx443603-100ug 100 ug
EUR 678

Ataxin 1 (ATXN1) Antibody (PerCP)

abx444147-100ug 100 ug
EUR 693.6

Ataxin 1 (ATXN1) Antibody (PerCP)

abx444165-100ug 100 ug
EUR 693.6

Ataxin 1 (ATXN1) Antibody (RPE)

abx444428-100ug 100 ug
EUR 693.6

Ataxin 1 (ATXN1) Antibody (RPE)

abx444446-100ug 100 ug
EUR 693.6

Ataxin 1 (ATXN1) Antibody (Streptavidin)

abx444709-100ug 100 ug
EUR 693.6

Ataxin 1 (ATXN1) Antibody (Streptavidin)

abx444727-100ug 100 ug
EUR 693.6

Phospho-Ataxin 1 (Ser775) Antibody

AF3347 200ul
EUR 420

Ataxin-1 Polyclonal Conjugated Antibody

C40621 100ul
EUR 476.4

Monoclonal antibody for Ataxin 1

SMC-455D 0.1mg
EUR 423.6
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical). . The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is not conjugated.

Monoclonal antibody for Ataxin 1

SMC-455D-A390 0.1mg
EUR 480
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical). . The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with ATTO 390.

Monoclonal antibody for Ataxin 1

SMC-455D-A488 0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical). . The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with ATTO 488.

Monoclonal antibody for Ataxin 1

SMC-455D-A565 0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical). . The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with ATTO 565.

Monoclonal antibody for Ataxin 1

SMC-455D-A594 0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical). . The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with ATTO 594.

Monoclonal antibody for Ataxin 1

SMC-455D-A633 0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical). . The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with ATTO 633.

Monoclonal antibody for Ataxin 1

SMC-455D-A655 0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical). . The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with ATTO 655.

Monoclonal antibody for Ataxin 1

SMC-455D-A680 0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical). . The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with ATTO 680.

Monoclonal antibody for Ataxin 1

SMC-455D-A700 0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical). . The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with ATTO 700.

Monoclonal antibody for Ataxin 1

SMC-455D-ALP 0.1mg
EUR 471.6
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical). . The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with Alkaline Phosphatase.

Monoclonal antibody for Ataxin 1

SMC-455D-APC 0.1mg
EUR 477.6
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical). . The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with APC.

Monoclonal antibody for Ataxin 1

SMC-455D-APCCY7 0.1mg
EUR 564
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical). . The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with APC/Cy7.

Monoclonal antibody for Ataxin 1

SMC-455D-BI 0.1mg
EUR 474
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical). . The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with Biotin.

Monoclonal antibody for Ataxin 1

SMC-455D-DY350 0.1mg
EUR 495.6
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical). . The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with Dylight 350.

Monoclonal antibody for Ataxin 1

SMC-455D-DY405 0.1mg
EUR 482.4
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical). . The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with Dylight 405.

Monoclonal antibody for Ataxin 1

SMC-455D-DY488 0.1mg
EUR 470.4
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical). . The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with Dylight 488.

Monoclonal antibody for Ataxin 1

SMC-455D-DY594 0.1mg
EUR 472.8
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical). . The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with Dylight 594.

Monoclonal antibody for Ataxin 1

SMC-455D-DY633 0.1mg
EUR 466.8
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical). . The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with Dylight 633.

Monoclonal antibody for Ataxin 1

SMC-455D-FITC 0.1mg
EUR 469.2
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical). . The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with FITC.

Monoclonal antibody for Ataxin 1

SMC-455D-HRP 0.1mg
EUR 464.4
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical). . The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with HRP.

Monoclonal antibody for Ataxin 1

SMC-455D-P594 0.1mg
EUR 487.2
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical). . The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with PE/ATTO 594.

Monoclonal antibody for Ataxin 1

SMC-455D-PCP 0.1mg
EUR 477.6
Description: A monoclonal antibody from clone S76-8 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical). . The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with PerCP.

Monoclonal antibody for Ataxin 1

SMC-455D-RPE 0.1mg
EUR 475.2
Description: A monoclonal antibody from clone S76-8 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical). . The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with RPE.

Monoclonal antibody for Ataxin 1

SMC-455D-STR 0.1mg
EUR 476.4
Description: A monoclonal antibody from clone S76-8 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical). . The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with Streptavidin.

Monoclonal antibody for Ataxin 1

SMC-455S 0.012mg
EUR 78
Description: A monoclonal antibody from clone S76-8 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical). . The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is not conjugated.

Monoclonal antibody for Ataxin 1

SMC-475D 0.1mg
EUR 423.6
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical). . The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is not conjugated.

Monoclonal antibody for Ataxin 1

SMC-475D-A390 0.1mg
EUR 480
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical). . The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with ATTO 390.

Monoclonal antibody for Ataxin 1

SMC-475D-A488 0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical). . The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with ATTO 488.

Monoclonal antibody for Ataxin 1

SMC-475D-A565 0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical). . The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with ATTO 565.

Monoclonal antibody for Ataxin 1

SMC-475D-A594 0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical). . The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with ATTO 594.

Monoclonal antibody for Ataxin 1

SMC-475D-A633 0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical). . The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with ATTO 633.

Monoclonal antibody for Ataxin 1

SMC-475D-A655 0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical). . The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with ATTO 655.

Monoclonal antibody for Ataxin 1

SMC-475D-A680 0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical). . The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with ATTO 680.

Monoclonal antibody for Ataxin 1

SMC-475D-A700 0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical). . The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with ATTO 700.

Monoclonal antibody for Ataxin 1

SMC-475D-ALP 0.1mg
EUR 471.6
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical). . The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with Alkaline Phosphatase.

Monoclonal antibody for Ataxin 1

SMC-475D-APC 0.1mg
EUR 477.6
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical). . The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with APC.

Monoclonal antibody for Ataxin 1

SMC-475D-APCCY7 0.1mg
EUR 564
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical). . The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with APC/Cy7.

Monoclonal antibody for Ataxin 1

SMC-475D-BI 0.1mg
EUR 474
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical). . The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with Biotin.

Monoclonal antibody for Ataxin 1

SMC-475D-DY350 0.1mg
EUR 495.6
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical). . The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with Dylight 350.

Monoclonal antibody for Ataxin 1

SMC-475D-DY405 0.1mg
EUR 482.4
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical). . The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with Dylight 405.

Monoclonal antibody for Ataxin 1

SMC-475D-DY488 0.1mg
EUR 470.4
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical). . The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with Dylight 488.

Monoclonal antibody for Ataxin 1

SMC-475D-DY594 0.1mg
EUR 472.8
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical). . The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with Dylight 594.

Monoclonal antibody for Ataxin 1

SMC-475D-DY633 0.1mg
EUR 466.8
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical). . The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with Dylight 633.

Monoclonal antibody for Ataxin 1

SMC-475D-FITC 0.1mg
EUR 469.2
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical). . The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with FITC.

Monoclonal antibody for Ataxin 1

SMC-475D-HRP 0.1mg
EUR 464.4
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical). . The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with HRP.

Monoclonal antibody for Ataxin 1

SMC-475D-P594 0.1mg
EUR 487.2
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical). . The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with PE/ATTO 594.

Monoclonal antibody for Ataxin 1

SMC-475D-PCP 0.1mg
EUR 477.6
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical). . The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with PerCP.

Monoclonal antibody for Ataxin 1

SMC-475D-RPE 0.1mg
EUR 475.2
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical). . The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with RPE.

Monoclonal antibody for Ataxin 1

SMC-475D-STR 0.1mg
EUR 476.4
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical). . The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with Streptavidin.

Monoclonal antibody for Ataxin 1

SMC-475S 0.012mg
EUR 78
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical). . The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is not conjugated.

Histone H3K4 Methylation Antibody Panel Pack

  • EUR 754.26
  • EUR 470.80
  • 3 x 25 µg
  • 3 x 25 ul

Histone H3K9 Methylation Antibody Panel Pack

  • EUR 754.26
  • EUR 470.80
  • 3 x 25 µg
  • 3 x 25 ul

Histone H3K27 Methylation Antibody Panel Pack

  • EUR 754.26
  • EUR 470.80
  • 3 x 25 µg
  • 3 x 25 ul

Histone H3K36 Methylation Antibody Panel Pack

  • EUR 754.26
  • EUR 470.80
  • 3 x 25 µg
  • 3 x 25 ul

Histone H3K79 Methylation Antibody Panel Pack

  • EUR 754.26
  • EUR 470.80
  • 3 x 25 µg
  • 3 x 25 ul

Histone H4K20 Methylation Antibody Panel Pack

  • EUR 754.26
  • EUR 470.80
  • 3 x 25 µg
  • 3 x 25 ul

Histone H4 Acetylation Antibody Panel Pack

  • EUR 754.26
  • EUR 470.80
  • 4 x 25 µg
  • 4 x 25 ul

Histone H3 Phosphorylation Antibody Panel Pack

  • EUR 754.26
  • EUR 470.80
  • 3 x 25 µg
  • 3 x 25 ul

Histone H3R2 Methylation Antibody Panel Pack

  • EUR 754.26
  • EUR 470.80
  • 3 x 25 µg
  • 3 x 25 ul

Histone H3R8 Methylation Antibody Panel Pack

  • EUR 754.26
  • EUR 470.80
  • 3 x 25 µg
  • 3 x 25 ul

Histone H3R17 Methylation Antibody Panel Pack

  • EUR 754.26
  • EUR 470.80
  • 3 x 25 µg
  • 3 x 25 ul

Histone H3R26 Methylation Antibody Panel Pack

  • EUR 754.26
  • EUR 470.80
  • 3 x 25 µg
  • 3 x 25 ul

Histone H4R3 Methylation Antibody Panel Pack

  • EUR 754.26
  • EUR 470.80
  • 3 x 25 µg
  • 3 x 25 ul

DNA Methylation Antibody Panel Pack I

  • EUR 458.46
  • EUR 270.60
  • 2 x 25 ul

Histone H3 Acetylation Antibody Panel Pack I

  • EUR 928.26
  • EUR 588.50
  • 4 x 25 µg
  • 4 x 25 ul

Histone H3 Acetylation Antibody Panel Pack II

  • EUR 928.26
  • EUR 588.50
  • 4 x 25 µg
  • 4 x 25 ul

Ataxin 2 antibody

70R-50365 100 ul
EUR 292.8
Description: Purified Polyclonal Ataxin 2 antibody

Ataxin 10 antibody

70R-50914 100 ul
EUR 292.8
Description: Purified Polyclonal Ataxin 10 antibody

Ataxin 3 antibody

70R-13630 100 ul
EUR 548.4
Description: Affinity purified Rabbit polyclonal Ataxin 3 antibody

Ataxin 3 antibody

22437-100ul 100ul
EUR 468

Ataxin 3 Antibody

DF6375 200ul
EUR 420

Ataxin-2 Antibody

R31210 100 ug
EUR 419

Polyclonal Goat anti-GST μ-form

GST-ANTI-2 50 uL
EUR 336

Polyclonal Goat anti-GST p-form

GST-ANTI-3 50 uL
EUR 336

Histone H3 Methylation Antibody Panel Pack I – Active Genes

  • EUR 928.26
  • EUR 588.50
  • 4 x 25 µg
  • 4 x 25 ul

Histone H3 Methylation Antibody Panel Pack I – Repression Genes

  • EUR 928.26
  • EUR 588.50
  • 4 x 25 µg
  • 4 x 25 ul

Histone H3 Methylation Antibody Panel Pack II – Active Genes

  • EUR 754.26
  • EUR 470.80
  • 3 x 25 µg
  • 3 x 25 ul

Histone H3 Methylation Antibody Panel Pack II – Repression Genes

  • EUR 928.26
  • EUR 588.50
  • 4 x 25 µg
  • 4 x 25 ul

Histone H3 Methylation Antibody Panel Pack III – Active Genes

  • EUR 928.26
  • EUR 588.50
  • 4 x 25 µg
  • 4 x 25 ul

Ataxin 1 Blocking Peptide

  • EUR 326.40
  • EUR 493.20
  • 1 mg
  • 5 mg

Ataxin 1 Blocking Peptide

AF6347-BP 1mg
EUR 234

Recombinant Ataxin 1 (ATXN1)

  • EUR 582.34
  • EUR 279.60
  • EUR 1853.76
  • EUR 697.92
  • EUR 1275.84
  • EUR 465.60
  • EUR 4454.40
  • 100 ug
  • 10ug
  • 1 mg
  • 200 ug
  • 500 ug
  • 50ug
  • 5 mg
Description: Recombinant Human Ataxin 1 expressed in: E.coli

Recombinant Ataxin 1 (ATXN1)

  • EUR 623.20
  • EUR 290.40
  • EUR 2006.98
  • EUR 748.99
  • EUR 1377.98
  • EUR 492.00
  • EUR 4837.44
  • 100 ug
  • 10ug
  • 1 mg
  • 200 ug
  • 500 ug
  • 50ug
  • 5 mg
Description: Recombinant Mouse Ataxin 1 expressed in: E.coli

Anti-EDG-1 Antibody

A01502-1 100ul
EUR 476.4
Description: Rabbit Polyclonal Antibody for EDG-1 Antibody (S1PR1) detection.tested for WB in Human, Mouse, Rat.

Anti-ROBO-1 Antibody

A01530-1 100ug
EUR 546
Description: Rabbit Polyclonal ROBO-1 Antibody. Validated in IF, IHC, WB and tested in Human, Mouse, Rat.

Anti-Bag-1 Antibody

A02423-1 50 ul
EUR 476.4
Description: Rabbit Polyclonal Bag-1 Antibody. Validated in IP, IHC and tested in Bovine, Canine, Human, Mouse, Rat.
Will increase within the variety of histidine decarboxylase (HDC)-positive cells and in Hdc mRNA expression had been present in hypocretin/ataxin-Three mice, and this improve was suppressed by LPS. Hypocretin loss didn’t affect the change in expression of hypothalamic inflammatory components in response to LPS, apart from interferon gamma and colony stimulating issue 3.

Leave a Reply

Your email address will not be published.