Ophthalmic Manifestations and Genetics of the Polyglutamine Autosomal Dominant Spinocerebellar Ataxias: A Review

Ophthalmic Manifestations and Genetics of the Polyglutamine Autosomal Dominant Spinocerebellar Ataxias: A Review

Spinocerebellar ataxia (SCA) is part of the cerebellar neurodegenerative illness group that’s numerous in genetics and phenotypes. It often exhibits autosomal dominant inheritance. SCAs, at all times along with the cerebellar degeneration, could exhibit scientific deficits in brainstem or eye, particularly retina or optic nerve. Apparently, autosomal dominant SCAs share a typical genetic mechanism; the size of the glutamine chain is abnormally expanded because of the improve within the cytosine-adenine-guanine (CAG) repeats of the illness inflicting gene. Research have urged that the mutant ataxin induces alteration of protein conformation and irregular aggregation leading to nuclear inclusions, and causes mobile lack of photoreceptors by way of a poisonous impact.

In consequence, these pathologic modifications induce a downregulation of genes concerned within the phototransduction, growth, and differentiation of photoreceptors resembling CRX, one of many photoreceptor transcription components. Nonetheless, the precise mechanism of neuronal degeneration by mutant ataxin restricted to solely sure sort of neuronal cell together with cerebellar Purkinje neurons and photoreceptor continues to be unclear. The commonest SCAs are varieties 1, 2, 3, 6, 7, and 17 which comprise about 80% of autosomal dominant SCA instances. Numerous elements of eye motion abnormalities are evident relying on the diploma of cerebellar and brainstem degeneration in SCAs. As well as, sure varieties of SCAs resembling SCA7 are characterised by each cerebellar ataxia and visible loss primarily because of retinal degeneration.

The severity of the retinopathy can fluctuate from occult macular photoreceptor disruption to in depth retinal atrophy and is correlated with the variety of CAG repeats. The worth of utilizing optical coherence tomography along side electrodiagnostic and genetic testing is emphasised as the mix of those exams can present vital data concerning the etiology, morphological analysis, and purposeful significances. Due to this fact, ophthalmologists want to acknowledge and differentiate SCAs to be able to correctly diagnose and consider the illness. On this assessment, we’ve described and mentioned SCAs displaying ophthalmic abnormalities with explicit consideration to their ophthalmic options, neurodegenerative mechanisms, genetics, and future views.

The blood-brain barrier is disrupted in Machado-Joseph illness/spinocerebellar ataxia sort 3: proof from transgenic mice and human autopsy samples

Blood-brain barrier (BBB) disruption is a typical characteristic in neurodegenerative ailments. Nonetheless, BBB integrity has not been assessed in spinocerebellar ataxias resembling Machado-Joseph illness/SCA sort 3, a genetic dysfunction, triggered by polyglutamine-expanded ataxin-3. To analyze that, BBB integrity was evaluated in a transgenic mouse mannequin of MJD and in human autopsy mind tissues.Firstly, we investigated the BBB permeability in MJD mice by: i) assessing the extravasation of the Evans blue (EB) dye and blood-borne proteins (e.g fibrinogen) within the cerebellum by immunofluorescence, and ii) in vivo Dynamic Distinction Enhanced-Magnetic Resonance Imaging.
The presence of ataxin-Three aggregates in mind blood vessels and the degrees of tight junction (TJ)-associated proteins had been additionally explored by immunofluorescence and western blotting. Human mind samples had been used to verify BBB permeability by evaluating fibrinogen extravasation, co-localization of ataxin-Three aggregates with mind blood vessels and neuroinflammation.Within the cerebellum of the mouse mannequin of MJD, there was a 5-fold improve in EB accumulation when in comparison with age-matched controls. Furthermore, vascular permeability displayed a 13-fold improve demonstrated by DCE-MRI. These outcomes had been validated by the 2-fold improve in fibrinogen extravasation in transgenic animals evaluating to controls.
Apparently, mutant ataxin-Three aggregates had been detected in cerebellar blood vessels of transgenic mice, accompanied by alterations of TJ-associated proteins in cerebellar endothelial cells, particularly a 29% lower in claudin-5 oligomers and a 10-fold improve in an occludin cleavage fragment. These outcomes had been validated in autopsy mind samples from MJD sufferers as we detected fibrinogen extravasation throughout BBB, the presence of ataxin-Three aggregates in blood vessels and related microgliosis.Altogether, our outcomes show BBB impairment in MJD/SCA3. These findings contribute for a greater understanding of the illness mechanisms and opens the chance to deal with MJD with medicinal merchandise that in regular situations wouldn’t cross the BBB.
 Ophthalmic Manifestations and Genetics of the Polyglutamine Autosomal Dominant Spinocerebellar Ataxias: A Review

Ophthalmic Manifestations and Genetics of the Polyglutamine Autosomal Dominant Spinocerebellar Ataxias: A Review

Hypocretin/orexin loss modifications the hypothalamic immune response.

Hypocretin, also called orexin, maintains the vigilance state and regulates varied physiological processes, resembling arousal, sleep, meals consumption, vitality expenditure, and reward. Beforehand, we discovered that when wild-type mice and hypocretin/ataxin-Three littermates (that are depleted of hypothalamic hypocretin-expressing neurons postnatally) had been administered lipopolysaccharide (LPS), the 2 genotypes exhibited important variations of their sleep/wake cycle, together with variations within the diploma of improve in sleep durations and in restoration from illness behaviour.
Within the current examine, we examined modifications within the hypothalamic vigilance system and within the hypothalamic expression of inflammatory components in response to LPS in hypocretin/ataxin-Three mice. Peripheral immune problem with LPS affected the hypothalamic immune response and vigilance states. This response was altered by the lack of hypocretin. Hypocretin expression was inhibited after LPS injection in each hypocretin/ataxin-Three mice and their wild-type littermates, however expression was utterly abolished solely in hypocretin/ataxin-Three mice.

Polyclonal Goat anti-GST α-form

GST-ANTI-1 50 uL
EUR 280

Anti-Ataxin 1/ATXN1 Antibody

PA2097 100ug/vial
EUR 294

Anti-Ataxin 1/ATXN1 Antibody

PB9422 100ug/vial
EUR 334

Anti-Ataxin 1 (4C5)

YF-MA15341 100 ug
EUR 363
Description: Mouse monoclonal to Ataxin 1

Anti-Phospho-Ataxin-1 (S776) antibody

STJ90696 200 µl
EUR 197
Description: Rabbit polyclonal to Phospho-Ataxin-1 (S776).

Anti-Ataxin-2L Antibody

A08149 100ul
EUR 397
Description: Rabbit Polyclonal Antibody for Ataxin-2L Antibody (ATXN2L) detection. Tested with WB in Human.

anti- Ataxin 2 antibody

FNab00657 100µg
EUR 505.25
  • Recommended dilution: WB: 1:1000-1:4000
  • IP: 1:500-1:2000
  • IHC: 1:20-1:200
  • IF: 1:10-1:100
  • Immunogen: ataxin 2
  • Uniprot ID: Q99700
  • Gene ID: 6311
  • Research Area: Neuroscience, Metabolism
Description: Antibody raised against Ataxin 2

Anti-Ataxin 2 antibody

PAab00657 100 ug
EUR 355

Anti-Ataxin-2 antibody

STJ91739 200 µl
EUR 197
Description: Rabbit polyclonal to Ataxin-2.

Anti-Ataxin-2L antibody

STJ91740 200 µl
EUR 197
Description: Rabbit polyclonal to Ataxin-2L.

Anti-Ataxin-7L1 antibody

STJ91741 200 µl
EUR 197
Description: Rabbit polyclonal to Ataxin-7L1.

Ataxin 1 Antibody

AF6347 200ul
EUR 304
Description: Ataxin 1 Antibody detects endogenous levels of total Ataxin 1.

Ataxin 1 Antibody

ABF6347 100 ug
EUR 438

Anti-Ataxin 3/ATXN3 Antibody

PA1846 100ug/vial
EUR 334

Anti-Ataxin 3/ATXN3 Antibody

PB9423 100ug/vial
EUR 334

Ataxin-1 Polyclonal Antibody

40621-100ul 100ul
EUR 252

Ataxin-1 Polyclonal Antibody

40621-50ul 50ul
EUR 187

Ataxin 1 (pS776) Antibody

abx010423-100ug 100 ug
EUR 439
  • Shipped within 5-10 working days.

Ataxin 1 (ATXN1) Antibody

abx010425-100ul 100 ul
EUR 411
  • Shipped within 5-10 working days.

Ataxin 1 (ATXN1) Antibody

20-abx004749
  • EUR 411.00
  • EUR 592.00
  • EUR 182.00
  • EUR 314.00
  • 100 ul
  • 200 ul
  • 20 ul
  • 50 ul
  • Shipped within 5-10 working days.

Ataxin 1 (ATXN1) Antibody

20-abx214569
  • EUR 411.00
  • EUR 300.00
  • 100 ul
  • 50 ul
  • Shipped within 5-10 working days.

Ataxin 1 (ATXN1) Antibody

20-abx100304
  • EUR 398.00
  • EUR 133.00
  • EUR 1107.00
  • EUR 537.00
  • EUR 314.00
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug
  • Shipped within 5-7 working days.

Ataxin 1 (pS775) Antibody

20-abx121842
  • EUR 314.00
  • EUR 467.00
  • EUR 203.00
  • 100 ul
  • 200 ul
  • 30 ul
  • Shipped within 5-10 working days.

Ataxin 1 (ATXN1) Antibody

20-abx126836
  • EUR 411.00
  • EUR 592.00
  • 100 ul
  • 200 ul
  • Shipped within 5-10 working days.

Ataxin 1 (ATXN1) Antibody

20-abx129635
  • EUR 411.00
  • EUR 133.00
  • EUR 1135.00
  • EUR 551.00
  • EUR 314.00
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug
  • Shipped within 5-7 working days.

Ataxin 1 (ATXN1) Antibody

20-abx133167
  • EUR 300.00
  • EUR 439.00
  • EUR 189.00
  • 100 ul
  • 200 ul
  • 30 ul
  • Shipped within 5-10 working days.

Ataxin 1 (ATXN1) Antibody

abx145346-100ug 100 ug
EUR 391
  • Shipped within 5-10 working days.

Ataxin 1 (ATXN1) Antibody

20-abx171342
  • EUR 787.00
  • EUR 411.00
  • 1 mg
  • 200 ug
  • Please enquire.

Ataxin 1 (ATXN1) Antibody

abx031721-400ul 400 ul
EUR 523
  • Shipped within 5-10 working days.

Ataxin 1 (ATXN1) Antibody

abx031721-80l 80 µl
EUR 286
  • Shipped within 5-10 working days.

Ataxin 1 (ATXN1) Antibody

20-abx242069
  • EUR 411.00
  • EUR 300.00
  • 100 ul
  • 50 ul
  • Shipped within 5-10 working days.

Ataxin 1 (ATXN1) Antibody

20-abx320078
  • EUR 300.00
  • EUR 244.00
  • 100 ul
  • 50 ul
  • Shipped within 5-10 working days.

Ataxin 1 (ATXN1) Antibody

20-abx325351
  • EUR 314.00
  • EUR 244.00
  • 100 ug
  • 50 ug
  • Shipped within 5-10 working days.

Ataxin 1 (ATXN1) Antibody

abx431572-200ul 200 ul
EUR 286
  • Shipped within 1-3 working days.

Ataxin 1 (ATXN1) Antibody

abx432383-200ul 200 ul
EUR 286
  • Shipped within 1-3 working days.

Ataxin 1 (ATXN1) Antibody

abx445066-100ug 100 ug
EUR 523
  • Shipped within 5-12 working days.

Ataxin 1 (ATXN1) Antibody

abx445084-100ug 100 ug
EUR 523
  • Shipped within 5-12 working days.

Ataxin-1 Polyclonal Antibody

ABP50719-003ml 0.03ml
EUR 158
  • Immunogen information: Synthesized peptide derived from human Ataxin-1 around the non-phosphorylation site of S776
  • Applications tips:
Description: A polyclonal antibody for detection of Ataxin-1 from Human, Mouse. This Ataxin-1 antibody is for WB , IHC-P, IF, ELISA. It is affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogenand is unconjugated. The antibody is produced in rabbit by using as an immunogen synthesized peptide derived from human Ataxin-1 around the non-phosphorylation site of S776

Ataxin-1 Polyclonal Antibody

ABP50719-01ml 0.1ml
EUR 289
  • Immunogen information: Synthesized peptide derived from human Ataxin-1 around the non-phosphorylation site of S776
  • Applications tips:
Description: A polyclonal antibody for detection of Ataxin-1 from Human, Mouse. This Ataxin-1 antibody is for WB , IHC-P, IF, ELISA. It is affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogenand is unconjugated. The antibody is produced in rabbit by using as an immunogen synthesized peptide derived from human Ataxin-1 around the non-phosphorylation site of S776

Ataxin-1 Polyclonal Antibody

ABP50719-02ml 0.2ml
EUR 414
  • Immunogen information: Synthesized peptide derived from human Ataxin-1 around the non-phosphorylation site of S776
  • Applications tips:
Description: A polyclonal antibody for detection of Ataxin-1 from Human, Mouse. This Ataxin-1 antibody is for WB , IHC-P, IF, ELISA. It is affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogenand is unconjugated. The antibody is produced in rabbit by using as an immunogen synthesized peptide derived from human Ataxin-1 around the non-phosphorylation site of S776

Ataxin-1 Polyclonal Antibody

ES1718-100ul 100ul
EUR 279
Description: A Rabbit Polyclonal antibody against Ataxin-1 from Human/Mouse. This antibody is tested and validated for WB, ELISA, IHC, IF, WB, ELISA

Ataxin-1 Polyclonal Antibody

ES1718-50ul 50ul
EUR 207
Description: A Rabbit Polyclonal antibody against Ataxin-1 from Human/Mouse. This antibody is tested and validated for WB, ELISA, IHC, IF, WB, ELISA

Ataxin 1 (Phospho-Ser776) Antibody

12034-100ul 100ul
EUR 252

Ataxin 1 (Phospho-Ser776) Antibody

12034-50ul 50ul
EUR 187

Ataxin 1 Like (ATXN1L) Antibody

abx030547-400ul 400 ul
EUR 523
  • Shipped within 5-10 working days.

Ataxin 1 Like (ATXN1L) Antibody

abx030547-80l 80 µl
EUR 286
  • Shipped within 5-10 working days.

Phospho-Ataxin 1 (Ser775) Antibody

AF3347 200ul
EUR 304
Description: Phospho-Ataxin 1 (Ser775) Antibody detects endogenous levels of Ataxin 1 only when phosphorylated at Serine 775.

Ataxin-1 Polyclonal Conjugated Antibody

C40621 100ul
EUR 397

Ataxin 1 (ATXN1) Antibody (ALP)

abx442463-100ug 100 ug
EUR 578
  • Shipped within 5-12 working days.

Ataxin 1 (ATXN1) Antibody (ALP)

abx442481-100ug 100 ug
EUR 578
  • Shipped within 5-12 working days.

Ataxin 1 (ATXN1) Antibody (APC)

abx442744-100ug 100 ug
EUR 578
  • Shipped within 5-12 working days.

Ataxin 1 (ATXN1) Antibody (APC)

abx442762-100ug 100 ug
EUR 578
  • Shipped within 5-12 working days.

Ataxin 1 (ATXN1) Antibody (Biotin)

abx443024-100ug 100 ug
EUR 578
  • Shipped within 5-12 working days.

Ataxin 1 (ATXN1) Antibody (Biotin)

abx443042-100ug 100 ug
EUR 578
  • Shipped within 5-12 working days.

Ataxin 1 (ATXN1) Antibody (FITC)

abx443304-100ug 100 ug
EUR 565
  • Shipped within 5-12 working days.

Ataxin 1 (ATXN1) Antibody (FITC)

abx443322-100ug 100 ug
EUR 565
  • Shipped within 5-12 working days.

Ataxin 1 (ATXN1) Antibody (HRP)

abx443585-100ug 100 ug
EUR 565
  • Shipped within 5-12 working days.

Ataxin 1 (ATXN1) Antibody (HRP)

abx443603-100ug 100 ug
EUR 565
  • Shipped within 5-12 working days.

Ataxin 1 (ATXN1) Antibody (PerCP)

abx444147-100ug 100 ug
EUR 578
  • Shipped within 5-12 working days.

Ataxin 1 (ATXN1) Antibody (PerCP)

abx444165-100ug 100 ug
EUR 578
  • Shipped within 5-12 working days.

Ataxin 1 (ATXN1) Antibody (RPE)

abx444428-100ug 100 ug
EUR 578
  • Shipped within 5-12 working days.

Ataxin 1 (ATXN1) Antibody (RPE)

abx444446-100ug 100 ug
EUR 578
  • Shipped within 5-12 working days.

Ataxin 1 (ATXN1) Antibody (Streptavidin)

abx444709-100ug 100 ug
EUR 578
  • Shipped within 5-12 working days.

Ataxin 1 (ATXN1) Antibody (Streptavidin)

abx444727-100ug 100 ug
EUR 578
  • Shipped within 5-12 working days.

Ataxin 1 Like (ATXN1L) Antibody

20-abx301794
  • EUR 411.00
  • EUR 1845.00
  • EUR 599.00
  • EUR 182.00
  • EUR 300.00
  • 100 ug
  • 1 mg
  • 200 ug
  • 20 ug
  • 50 ug
  • Shipped within 5-10 working days.

Phospho- Ataxin 1 (Ser775) Antibody

ABF3347 100 ug
EUR 438

Monoclonal antibody for Ataxin 1

SMC-475D 0.1mg
EUR 353
  • Ataxin-1 is a member of the ATXN1 protein family and contains a single AXH domain. It is a neurodegenerative disorder protein thought to have a role in the metabolism of RNA as it has been shown to localize to the RNA and transcription dependent incl
  • Show more
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical). . The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is not conjugated.

Monoclonal antibody for Ataxin 1

SMC-475D-A390 0.1mg
EUR 400
  • Ataxin-1 is a member of the ATXN1 protein family and contains a single AXH domain. It is a neurodegenerative disorder protein thought to have a role in the metabolism of RNA as it has been shown to localize to the RNA and transcription dependent incl
  • Show more
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical). . The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with ATTO 390.

Monoclonal antibody for Ataxin 1

SMC-475D-A488 0.1mg
EUR 399
  • Ataxin-1 is a member of the ATXN1 protein family and contains a single AXH domain. It is a neurodegenerative disorder protein thought to have a role in the metabolism of RNA as it has been shown to localize to the RNA and transcription dependent incl
  • Show more
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical). . The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with ATTO 488.

Monoclonal antibody for Ataxin 1

SMC-475D-A565 0.1mg
EUR 399
  • Ataxin-1 is a member of the ATXN1 protein family and contains a single AXH domain. It is a neurodegenerative disorder protein thought to have a role in the metabolism of RNA as it has been shown to localize to the RNA and transcription dependent incl
  • Show more
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical). . The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with ATTO 565.

Monoclonal antibody for Ataxin 1

SMC-475D-A594 0.1mg
EUR 399
  • Ataxin-1 is a member of the ATXN1 protein family and contains a single AXH domain. It is a neurodegenerative disorder protein thought to have a role in the metabolism of RNA as it has been shown to localize to the RNA and transcription dependent incl
  • Show more
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical). . The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with ATTO 594.

Monoclonal antibody for Ataxin 1

SMC-475D-A633 0.1mg
EUR 399
  • Ataxin-1 is a member of the ATXN1 protein family and contains a single AXH domain. It is a neurodegenerative disorder protein thought to have a role in the metabolism of RNA as it has been shown to localize to the RNA and transcription dependent incl
  • Show more
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical). . The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with ATTO 633.

Monoclonal antibody for Ataxin 1

SMC-475D-A655 0.1mg
EUR 399
  • Ataxin-1 is a member of the ATXN1 protein family and contains a single AXH domain. It is a neurodegenerative disorder protein thought to have a role in the metabolism of RNA as it has been shown to localize to the RNA and transcription dependent incl
  • Show more
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical). . The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with ATTO 655.

Monoclonal antibody for Ataxin 1

SMC-475D-A680 0.1mg
EUR 399
  • Ataxin-1 is a member of the ATXN1 protein family and contains a single AXH domain. It is a neurodegenerative disorder protein thought to have a role in the metabolism of RNA as it has been shown to localize to the RNA and transcription dependent incl
  • Show more
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical). . The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with ATTO 680.

Monoclonal antibody for Ataxin 1

SMC-475D-A700 0.1mg
EUR 399
  • Ataxin-1 is a member of the ATXN1 protein family and contains a single AXH domain. It is a neurodegenerative disorder protein thought to have a role in the metabolism of RNA as it has been shown to localize to the RNA and transcription dependent incl
  • Show more
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical). . The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with ATTO 700.

Monoclonal antibody for Ataxin 1

SMC-475D-ALP 0.1mg
EUR 393
  • Ataxin-1 is a member of the ATXN1 protein family and contains a single AXH domain. It is a neurodegenerative disorder protein thought to have a role in the metabolism of RNA as it has been shown to localize to the RNA and transcription dependent incl
  • Show more
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical). . The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with Alkaline Phosphatase.

Monoclonal antibody for Ataxin 1

SMC-475D-APC 0.1mg
EUR 398
  • Ataxin-1 is a member of the ATXN1 protein family and contains a single AXH domain. It is a neurodegenerative disorder protein thought to have a role in the metabolism of RNA as it has been shown to localize to the RNA and transcription dependent incl
  • Show more
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical). . The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with APC.

Monoclonal antibody for Ataxin 1

SMC-475D-APCCY7 0.1mg
EUR 470
  • Ataxin-1 is a member of the ATXN1 protein family and contains a single AXH domain. It is a neurodegenerative disorder protein thought to have a role in the metabolism of RNA as it has been shown to localize to the RNA and transcription dependent incl
  • Show more
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical). . The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with APC/Cy7.

Monoclonal antibody for Ataxin 1

SMC-475D-BI 0.1mg
EUR 395
  • Ataxin-1 is a member of the ATXN1 protein family and contains a single AXH domain. It is a neurodegenerative disorder protein thought to have a role in the metabolism of RNA as it has been shown to localize to the RNA and transcription dependent incl
  • Show more
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical). . The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with Biotin.

Monoclonal antibody for Ataxin 1

SMC-475D-DY350 0.1mg
EUR 413
  • Ataxin-1 is a member of the ATXN1 protein family and contains a single AXH domain. It is a neurodegenerative disorder protein thought to have a role in the metabolism of RNA as it has been shown to localize to the RNA and transcription dependent incl
  • Show more
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical). . The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with Dylight 350.

Monoclonal antibody for Ataxin 1

SMC-475D-DY405 0.1mg
EUR 402
  • Ataxin-1 is a member of the ATXN1 protein family and contains a single AXH domain. It is a neurodegenerative disorder protein thought to have a role in the metabolism of RNA as it has been shown to localize to the RNA and transcription dependent incl
  • Show more
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical). . The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with Dylight 405.

Monoclonal antibody for Ataxin 1

SMC-475D-DY488 0.1mg
EUR 392
  • Ataxin-1 is a member of the ATXN1 protein family and contains a single AXH domain. It is a neurodegenerative disorder protein thought to have a role in the metabolism of RNA as it has been shown to localize to the RNA and transcription dependent incl
  • Show more
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical). . The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with Dylight 488.

Monoclonal antibody for Ataxin 1

SMC-475D-DY594 0.1mg
EUR 394
  • Ataxin-1 is a member of the ATXN1 protein family and contains a single AXH domain. It is a neurodegenerative disorder protein thought to have a role in the metabolism of RNA as it has been shown to localize to the RNA and transcription dependent incl
  • Show more
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical). . The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with Dylight 594.

Monoclonal antibody for Ataxin 1

SMC-475D-DY633 0.1mg
EUR 389
  • Ataxin-1 is a member of the ATXN1 protein family and contains a single AXH domain. It is a neurodegenerative disorder protein thought to have a role in the metabolism of RNA as it has been shown to localize to the RNA and transcription dependent incl
  • Show more
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical). . The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with Dylight 633.

Monoclonal antibody for Ataxin 1

SMC-475D-FITC 0.1mg
EUR 391
  • Ataxin-1 is a member of the ATXN1 protein family and contains a single AXH domain. It is a neurodegenerative disorder protein thought to have a role in the metabolism of RNA as it has been shown to localize to the RNA and transcription dependent incl
  • Show more
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical). . The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with FITC.

Monoclonal antibody for Ataxin 1

SMC-475D-HRP 0.1mg
EUR 387
  • Ataxin-1 is a member of the ATXN1 protein family and contains a single AXH domain. It is a neurodegenerative disorder protein thought to have a role in the metabolism of RNA as it has been shown to localize to the RNA and transcription dependent incl
  • Show more
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical). . The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with HRP.

Monoclonal antibody for Ataxin 1

SMC-475D-P594 0.1mg
EUR 406
  • Ataxin-1 is a member of the ATXN1 protein family and contains a single AXH domain. It is a neurodegenerative disorder protein thought to have a role in the metabolism of RNA as it has been shown to localize to the RNA and transcription dependent incl
  • Show more
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical). . The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with PE/ATTO 594.

Monoclonal antibody for Ataxin 1

SMC-475D-PCP 0.1mg
EUR 398
  • Ataxin-1 is a member of the ATXN1 protein family and contains a single AXH domain. It is a neurodegenerative disorder protein thought to have a role in the metabolism of RNA as it has been shown to localize to the RNA and transcription dependent incl
  • Show more
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical). . The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with PerCP.

Monoclonal antibody for Ataxin 1

SMC-475D-RPE 0.1mg
EUR 396
  • Ataxin-1 is a member of the ATXN1 protein family and contains a single AXH domain. It is a neurodegenerative disorder protein thought to have a role in the metabolism of RNA as it has been shown to localize to the RNA and transcription dependent incl
  • Show more
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical). . The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with RPE.

Monoclonal antibody for Ataxin 1

SMC-475D-STR 0.1mg
EUR 397
  • Ataxin-1 is a member of the ATXN1 protein family and contains a single AXH domain. It is a neurodegenerative disorder protein thought to have a role in the metabolism of RNA as it has been shown to localize to the RNA and transcription dependent incl
  • Show more
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical). . The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is conjugated with Streptavidin.

Monoclonal antibody for Ataxin 1

SMC-475S 0.012mg
EUR 65
  • Ataxin-1 is a member of the ATXN1 protein family and contains a single AXH domain. It is a neurodegenerative disorder protein thought to have a role in the metabolism of RNA as it has been shown to localize to the RNA and transcription dependent incl
  • Show more
Description: A monoclonal antibody from clone S65-37 against Human Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical). Human: 87% identity (14/16 amino acids identical). . The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Ataxin 1 is not conjugated.

Monoclonal antibody for Ataxin 1

SMC-455D 0.1mg
EUR 353
  • Ataxin-1 is a member of the ATXN1 protein family and contains a single AXH domain. It is a neurodegenerative disorder protein thought to have a role in the metabolism of RNA as it has been shown to localize to the RNA and transcription dependent incl
  • Show more
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical). . The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is not conjugated.

Monoclonal antibody for Ataxin 1

SMC-455D-A390 0.1mg
EUR 400
  • Ataxin-1 is a member of the ATXN1 protein family and contains a single AXH domain. It is a neurodegenerative disorder protein thought to have a role in the metabolism of RNA as it has been shown to localize to the RNA and transcription dependent incl
  • Show more
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical). . The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with ATTO 390.

Monoclonal antibody for Ataxin 1

SMC-455D-A488 0.1mg
EUR 399
  • Ataxin-1 is a member of the ATXN1 protein family and contains a single AXH domain. It is a neurodegenerative disorder protein thought to have a role in the metabolism of RNA as it has been shown to localize to the RNA and transcription dependent incl
  • Show more
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical). . The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with ATTO 488.

Monoclonal antibody for Ataxin 1

SMC-455D-A565 0.1mg
EUR 399
  • Ataxin-1 is a member of the ATXN1 protein family and contains a single AXH domain. It is a neurodegenerative disorder protein thought to have a role in the metabolism of RNA as it has been shown to localize to the RNA and transcription dependent incl
  • Show more
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical). . The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with ATTO 565.

Monoclonal antibody for Ataxin 1

SMC-455D-A594 0.1mg
EUR 399
  • Ataxin-1 is a member of the ATXN1 protein family and contains a single AXH domain. It is a neurodegenerative disorder protein thought to have a role in the metabolism of RNA as it has been shown to localize to the RNA and transcription dependent incl
  • Show more
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical). . The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with ATTO 594.

Monoclonal antibody for Ataxin 1

SMC-455D-A633 0.1mg
EUR 399
  • Ataxin-1 is a member of the ATXN1 protein family and contains a single AXH domain. It is a neurodegenerative disorder protein thought to have a role in the metabolism of RNA as it has been shown to localize to the RNA and transcription dependent incl
  • Show more
Description: A monoclonal antibody from clone S76-8 against Human | Mouse Ataxin 1. The host species for the production of this antibody is Mouse. The antigen used for immunization is Mouse Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical). . The antibody is tested and validated for WB, IHC, ICC/IF, IP assays with the following recommended dilutions: WB (1:1000), ICC/IF (1:100). This MAb for Ataxin 1 is conjugated with ATTO 633.
Will increase within the variety of histidine decarboxylase (HDC)-positive cells and in Hdc mRNA expression had been present in hypocretin/ataxin-Three mice, and this improve was suppressed by LPS. Hypocretin loss didn’t affect the change in expression of hypothalamic inflammatory components in response to LPS, apart from interferon gamma and colony stimulating issue 3.

Leave a Reply

Your email address will not be published. Required fields are marked *